DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CLN1

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_013926.1 Gene:CLN1 SGDID:S000004812 Length:546 Species:Saccharomyces cerevisiae

Alignment Length:368 Identity:70/369 (19%)
Similarity:140/369 (38%) Gaps:90/369 (24%)


  Fly   176 ETGVSPTGRVKELPPRNDRQRFL---EVVQ-YQMDILEYFRESEKKHRPKPLYMRRQKDIS-HNM 235
            :||:..|.:....|........|   |.:| |..:|.:.......|.:|....:.:|.::: |..
Yeast     7 KTGLIVTAKQTYYPIELSNAELLTHYETIQEYHEEISQNVLVQSSKTKPDIKLIDQQPEMNPHQT 71

  Fly   236 RSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAK--------- 291
            |..::.:|.::|...::.....:.:|.:.||:.|:..|::.:.:||....:::|||         
Yeast    72 REAIVTFLYQLSVMTRVSNGIFFHAVRFYDRYCSKRVVLKDQAKLVVGTCLWLAAKTWGGCNHII 136

  Fly   292 ----------YEEIYP----PEVGEFVFLT--DDSYTKAQVLRMEQVILKILSFDLCTPTAYVFI 340
                      :....|    |.:.|.|...  .|.:.::..::||:.||..|::|:..|    .|
Yeast   137 NNVSIPTGGRFYGPNPRARIPRLSELVHYCGGSDLFDESMFIQMERHILDTLNWDVYEP----MI 197

  Fly   341 NTYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITT 405
            |.|             .|.:.|..|::.|.|...|.:..|:          |.| |:.:.:..::
Yeast   198 NDY-------------ILNVDENCLIQYELYKNQLQNNNSN----------GKE-WSCKRKSQSS 238

  Fly   406 YKLEDLKTVVLHLCHT-HKTAKELNTQAMREKYNRDTYKKVAMMESVEMSKDDFDQLCEAYNCKQ 469
            ...:  .||..|:..: ..|..:.:|..|.|  :.:...|:.:   :.:.:...|..|..||..:
Yeast   239 DDSD--ATVEEHISSSPQSTGLDGDTTTMDE--DEELNSKIKL---INLKRFLIDLSCWQYNLLK 296

  Fly   470 KE----------------DEHQQP--------DINTKSNVNLF 488
            .|                ::.|.|        |||:.:...:|
Yeast   297 FELYEICNGMFSIINKFTNQDQGPFLSMPIGNDINSNTQTQVF 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 29/152 (19%)
Cyclin_C 334..450 CDD:281044 22/117 (19%)
CLN1NP_013926.1 COG5024 31..539 CDD:227357 65/345 (19%)
Cyclin_N 41..192 CDD:278560 29/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96065663
eggNOG 1 0.900 E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.