DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CCNB3

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_016885402.1 Gene:CCNB3 HGNCID:18709 Length:1404 Species:Homo sapiens

Alignment Length:534 Identity:153/535 (29%)
Similarity:242/535 (45%) Gaps:106/535 (20%)


  Fly     8 QDMSNKENPGIKIPAGVKNT--KQPLAVIGGKAEKNALAPRANFAVLNGNNNVPRPAGKVQVFRD 70
            :.:..:|.|.||     |.|  |:|||:     :.:.:.....|..:...|..| ..||...|::
Human   894 ESLDLQEKPSIK-----KETLLKKPLAL-----KMSTINEAVLFEDMIALNEKP-TTGKELSFKE 947

  Fly    71 --------------------VRNLNVDENVEYGA-----KKSNVVPVVEQFKTFSV-----YEDN 105
                                |..:....||...|     .||::..:....|:.::     :||.
Human   948 PLALQESPTYKEDTFLKTLLVPQVGTSPNVSSTAPESITSKSSIATMTSVGKSGTINEAFLFEDM 1012

  Fly   106 NDTQVAP-SGKSLA---SLVDKENHDVK-------FGAGQKELVDYDLDSTPMSVTD---VQSPM 156
            ......| :||.|:   .|..:|:...|       |...|.....|...:||.|:|:   :.:..
Human  1013 ITLNEKPTTGKELSFKEPLALQESPTCKEDTFLETFLIPQIGTSPYVFSTTPESITEKSSIATMT 1077

  Fly   157 SVDRSILGVIQSSDISVGTETGVSP--TGRVKE-LPPRNDRQR------FLEVVQYQMDILEYFR 212
            ||.:| ....:||.....::..|||  .|..|| :.||.|...      |..:  |..:|..|.:
Human  1078 SVGKS-RTTTESSACESASDKPVSPQAKGTPKEQITPREDIDEDSSDPSFNPM--YAKEIFSYMK 1139

  Fly   213 ESE-----KKHRPKPL--YMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQ 270
            |.|     :.|....|  ||.||.:|:.:||:||:||||||...:::..|||||:|..:|.:|.:
Human  1140 EREIEETAQSHEQFILTDYMNRQIEITSDMRAILVDWLVEVQVSFEMTHETLYLAVKLVDLYLMK 1204

  Fly   271 MAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPT 335
            ....:.||||:|..|..||||:||...|.|.:||::.||:|.:::||.||..||.:|..|:..|.
Human  1205 AVCKKDKLQLLGATAFMIAAKFEEHNSPRVDDFVYICDDNYQRSEVLSMEINILNVLKCDINIPI 1269

  Fly   336 AYVFINTYAVLCDMPEKLKYMTL--YISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTP 398
            ||.|:..|| .| :...:|.:||  ||.|::|.|.. |:|...|.:::||:.||.::..:..|.|
Human  1270 AYHFLRRYA-RC-IHTNMKTLTLSRYICEMTLQEYH-YVQEKASKLAAASLLLALYMKKLGYWVP 1331

  Fly   399 RLEEITTYKLEDLKTVVLHLCHTHKTAKELN----------TQAMREKYNRDTYKKVAMMESVEM 453
            .||..:.|.:.:|          |...::||          .:|:..||:...:.:||.:.:::|
Human  1332 FLEHYSGYSISEL----------HPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDM 1386

  Fly   454 SKDDFDQLCEAYNC 467
            .|     |.|..||
Human  1387 LK-----LEEILNC 1395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 56/133 (42%)
Cyclin_C 334..450 CDD:281044 36/128 (28%)
CCNB3XP_016885402.1 Cyclin_N 1133..1266 CDD:306612 56/133 (42%)
Cyclin_C 1268..1384 CDD:308564 36/129 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D520533at33208
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.