DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CLB6

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_011623.3 Gene:CLB6 SGDID:S000003341 Length:380 Species:Saccharomyces cerevisiae

Alignment Length:294 Identity:78/295 (26%)
Similarity:135/295 (46%) Gaps:54/295 (18%)


  Fly   200 VVQYQMDILEYFRESEKKHRPKPLYMRRQKDISH---NMRSILIDWLVEVSEEYKLDTETLYLSV 261
            |.:|...|..:..|.|.:..|...|:...:...|   :||::||||||||.|::....|||:|::
Yeast   117 VAEYTDSIFSHLYEKEIQMLPTHNYLMDTQSPYHLKSSMRALLIDWLVEVHEKFHCLPETLFLAI 181

  Fly   262 FYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKI 326
            ..|||||||..|..:||||:....::||.|:||:..|::..|.::||.:.|...:.:.|..:|..
Yeast   182 NLLDRFLSQNVVKLNKLQLLCITCLFIACKFEEVKLPKITNFAYVTDGAATVEGIRKAELFVLSS 246

  Fly   327 LSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHIL 391
            |.:::..|....||...:...:...:.:.|..:|.|.|:...: ::...||.:::.|:.:||.|.
Yeast   247 LGYNISLPNPLNFIRRISKADNYCIETRNMAKFIMEYSICCNK-FIHLKPSYLAAMSMYIARKIK 310

  Fly   392 ---------------GMEMWT-PRLEEITTYKLEDLKTVVLHLCHTHKTAKELNTQAMREKYNRD 440
                           |:::.: |..::..:..:||:            ...:.|..::|.||.:.
Yeast   311 NENSKWDETFIHYSGGIDIESDPAFKDFISELVEDI------------AVPDTNLDSLRLKYKKP 363

  Fly   441 ----TYKKVAMMESVEMSKDDFDQLCEAYNCKQK 470
                .|.||            ||.      ||||
Yeast   364 KHGMVYFKV------------FDW------CKQK 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 46/129 (36%)
Cyclin_C 334..450 CDD:281044 24/136 (18%)
CLB6NP_011623.3 COG5024 1..380 CDD:227357 78/295 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96108670
eggNOG 1 0.900 E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126649
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.730

Return to query results.
Submit another query.