DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CLB1

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_011622.1 Gene:CLB1 SGDID:S000003340 Length:471 Species:Saccharomyces cerevisiae

Alignment Length:502 Identity:115/503 (23%)
Similarity:208/503 (41%) Gaps:111/503 (22%)


  Fly     8 QDMSNKENPGIKIPAGVKNTKQPLAVIGGKAEKNALAPRANFAVLNG----NNNVPRPAGKVQVF 68
            |.:..|.|....|...|.|....|..|    ..|......||:.||.    .::|.|.......|
Yeast    25 QYILQKRNVPRTILGNVTNNANILQEI----SMNRKIGMKNFSKLNNFFPLKDDVSRADDFTSSF 85

  Fly    69 RDVRN------LNVDENV-EYGAKK------SNVVPVVEQFKTFS--------VYEDNN--DTQV 110
            .|.|.      ||..||: |||..:      ||    .:.|.|.|        :|.:|.  .||:
Yeast    86 NDSRQGVKQEVLNNKENIPEYGYSEQEKQQCSN----DDSFHTNSTALSCNRLIYSENKSISTQM 146

  Fly   111 ----------APSGKSLASLVDKEN------HDVKFGAGQKELVDYDLDSTPMSVTDVQSPMSVD 159
                      :...:.:::||::::      |::.  ..::.|.:|:.|.  :...|...|:.|.
Yeast   147 EWQKKIMREDSKKKRPISTLVEQDDQKKFKLHELT--TEEEVLEEYEWDD--LDEEDCDDPLMVS 207

  Fly   160 RSILGVIQSSDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLY 224
            ..:                                          .||.:|....|....|....
Yeast   208 EEV------------------------------------------NDIFDYLHHLEIITLPNKAN 230

  Fly   225 MRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIA 289
            :.:.|:|..| |.||::|::::..::.|..|||||::..:||||.:..|..::||||||:.::||
Yeast   231 LYKHKNIKQN-RDILVNWIIKIHNKFGLLPETLYLAINIMDRFLCEEVVQLNRLQLVGTSCLFIA 294

  Fly   290 AKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLK 354
            :||||||.|.:..|.:.||.:.:...:...|:.||:.|.|.:.......|:...:...|...:.:
Yeast   295 SKYEEIYSPSIKHFAYETDGACSVEDIKEGERFILEKLDFQISFANPMNFLRRISKADDYDIQSR 359

  Fly   355 YMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEE----ITTYKLEDLKTVV 415
            .:..::.|:|:::.: ::..||||.:||::.|:|.:||...|...|..    .|..||..    |
Yeast   360 TLAKFLMEISIVDFK-FIGILPSLCASAAMFLSRKMLGKGTWDGNLIHYSGGYTKAKLYP----V 419

  Fly   416 LHLCHTHKTAKELNTQAMREKYNRDTYKKVAMME---SVEMSKDDFD 459
            ..|...:.....::.:.:: ||....:.|.:::.   ::::.|:.:|
Yeast   420 CQLLMDYLVGSTIHDEFLK-KYQSRRFLKASIISIEWALKVRKNGYD 465

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 46/126 (37%)
Cyclin_C 334..450 CDD:281044 24/123 (20%)
CLB1NP_011622.1 COG5024 1..467 CDD:227357 115/503 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96066011
eggNOG 1 0.900 E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126649
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.730

Return to query results.
Submit another query.