DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCA2;4

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_178153.1 Gene:CYCA2;4 AraportID:AT1G80370 Length:461 Species:Arabidopsis thaliana

Alignment Length:445 Identity:142/446 (32%)
Similarity:219/446 (49%) Gaps:63/446 (14%)


  Fly    33 VIGGKAEKNALAPRANFAVLNGNNNVPRPAGKVQVFRDVRNLNVDENVEYGAKKSNVVPVVEQFK 97
            |:..|:::.||..:        ..|.|:   |..|.:|:.|:..:.:  |.:..|..|..::|.|
plant    49 VLRAKSKRTALDEK--------KANAPK---KRAVLKDITNVTCENS--YTSCFSVAVENIKQIK 100

  Fly    98 TFSVYEDNNDTQVAPSGKSLASLVDKENHDVKF-------GAGQKELVDYDLDSTPMSVTDVQSP 155
                    ...|.:.|.|..:|....:..|.|.       ||......|..|.:...|.:.:..|
plant   101 --------KGRQSSSSSKVASSSATSQVTDAKVEVVSNSAGASLSVFTDTSLGTNETSYSIIAKP 157

  Fly   156 MS---------VDRSILGVIQSSDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYF 211
            .|         |:||..|......:.:.::                |:...| ...|..||....
plant   158 SSRSPPRPFGTVERSCGGASSPKFVDIDSD----------------DKDPLL-CSLYAPDIYYNL 205

  Fly   212 RESEKKHRPKPLYMRR-QKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVR 275
            |.:|.|.||.|.:|.: |:|::..||.||:||||||||||.|..:||||:|:.:|.||....|.|
plant   206 RVAELKRRPFPDFMEKTQRDVTETMRGILVDWLVEVSEEYTLVPDTLYLTVYLIDWFLHGNYVER 270

  Fly   276 SKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFI 340
            .:|||:|...|.||:|||||:.|.:.||.|:||::||:.|||.||..:||..||.:.|||:..|:
plant   271 QRLQLLGITCMLIASKYEEIHAPRIEEFCFITDNTYTRDQVLEMESQVLKHFSFQIYTPTSKTFL 335

  Fly   341 NTY--AVLCDMPE---KLKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEM--WTP 398
            ..:  |.....|.   :::::..|::||:||: ..:|::|||::::::|.||:..|....  |.|
plant   336 RRFLRAAQVSFPNQSLEMEFLANYLTELTLMD-YPFLKFLPSIIAASAVFLAKWTLNQSSHPWNP 399

  Fly   399 RLEEITTYKLEDLKTVVLHLCHTHKTAKELNTQAMREKYNRDTYKKVAMMESVEM 453
            .||..||||..|||..|..|.......|..:..::|.||.:|.:|.||:..|.|:
plant   400 TLEHYTTYKASDLKASVHALQDLQLNTKGCSLNSIRMKYRQDKFKSVAVFSSGEL 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 65/127 (51%)
Cyclin_C 334..450 CDD:281044 39/123 (32%)
CYCA2;4NP_178153.1 Cyclin_N 200..326 CDD:278560 65/126 (52%)
Cyclin_C 329..451 CDD:281044 39/123 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H55562
Inparanoid 1 1.050 192 1.000 Inparanoid score I1330
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoInspector 1 1.000 T124214
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10177
Phylome 1 0.910 0.600 Consistency score
66.070

Return to query results.
Submit another query.