DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCB2;4

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001323249.1 Gene:CYCB2;4 AraportID:AT1G76310 Length:459 Species:Arabidopsis thaliana

Alignment Length:454 Identity:129/455 (28%)
Similarity:200/455 (44%) Gaps:93/455 (20%)


  Fly    63 GKV-----QVFRDVRNLNVDENVEYGA-------------------KKSNVVPVVEQF-KTFSVY 102
            |||     |..|.:.|:|  :|: .||                   ||...|||.... :.|:..
plant    25 GKVIPTNGQTRRALSNIN--KNI-IGAPVYPCAVKRPFTEKNGICNKKIPPVPVHRPVTRKFAAQ 86

  Fly   103 EDNNDTQVAPSGKSLASLVDKEN-----HDVKFGAGQKELVDYDLDSTPMSVTDVQSPMSVDRSI 162
            ...|:.|:.........|:..|.     .||:.|       |:   :.||.|...::.:.....:
plant    87 LAENNLQIHKEETKKPDLISNEALDRIITDVEEG-------DF---NEPMFVQHTEAMLEEIDKM 141

  Fly   163 LGV--IQSSDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYM 225
            .|:  ..|:||....|..|......       |:...|.||:|..||..:::::|.:....|.||
plant   142 EGIEMQDSNDIDAEVEESVMDIDSC-------DKNNPLSVVEYINDIYCFYKKNECRSCVPPNYM 199

  Fly   226 RRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLS-QMAVVRSKLQLVGTAAMYIA 289
            ..|.||:..||.||.|||:||..:::|..|||||::..:||||: ...:.|.||||||..||.:|
plant   200 ENQHDINERMRGILFDWLIEVHYKFELMEETLYLTINLIDRFLAVHQHIARKKLQLVGVTAMLLA 264

  Fly   290 AKYEEIYPPEVGEFVFLTDDSYTKAQVLRM----------------------------EQVILKI 326
            .||||:..|.|.:.:.::|.:||:.::|.|                            |:::...
plant   265 CKYEEVSVPVVDDLILISDKAYTRTEILDMVKSFTKSCPDYNHGCSALYVDDHYCVLQEKLMANT 329

  Fly   327 LSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHIL 391
            |.|:.|.||.|||:..:.......:||:.::.::.||.|:|.| .|||.||.::::::..|:..|
plant   330 LQFNFCLPTPYVFMRRFLKAAQSDKKLELLSFFMIELCLVEYE-MLQYTPSQLAASAIYTAQSTL 393

  Fly   392 -GMEMWTPRLEEITTYKLEDL-----KTVVLHLCHTHKTAKELNTQAMREKYNRDTYKKVAMME 449
             |.|.|:...|..:.|..|.|     |.|.||  |...|.|   ...:..|||...:...|.:|
plant   394 KGYEDWSKTSEFHSGYTEEALLECSRKMVGLH--HKAGTGK---LTGVHRKYNTSKFGYAARIE 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 52/155 (34%)
Cyclin_C 334..450 CDD:281044 38/123 (31%)
CYCB2;4NP_001323249.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126649
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.