DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCA3;2

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_564499.3 Gene:CYCA3;2 AraportID:AT1G47210 Length:372 Species:Arabidopsis thaliana

Alignment Length:319 Identity:118/320 (37%)
Similarity:183/320 (57%) Gaps:47/320 (15%)


  Fly   142 LDSTPMSVTDVQSPMSVDRSILGVIQSSDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMD 206
            :.|.|:::.|::|...:|                              .|:|..:...  .|..|
plant    73 IKSAPVAIIDLESKSDID------------------------------SRSDDPQMCG--PYVAD 105

  Fly   207 ILEYFRESE--KKHRPKPLYMRR-QKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFL 268
            |.||.|:.|  .|.||.|.|:.: |||::.:||.:|:||||||:|||||.:|||||:|.::||||
plant   106 IYEYLRQLEVKPKQRPLPDYIEKVQKDVTPSMRGVLVDWLVEVAEEYKLGSETLYLTVSHIDRFL 170

  Fly   269 SQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCT 333
            |...|.:.||||||.:||.||:|||||.||:|.:|.::||::::|..|::||..||..|.|:|..
plant   171 SLKTVNKQKLQLVGVSAMLIASKYEEISPPKVDDFCYITDNTFSKQDVVKMEADILLALQFELGR 235

  Fly   334 PTAYVFINTYAVLCDMPEKLKYMTL-----YISELSLMEGETYLQYLPSLMSSASVALARHILGM 393
            ||...|:..:..:.....|:.::.|     |:||||:::.:| ::::|||:::::|.|||.|:..
plant   236 PTINTFMRRFTRVAQDDFKVPHLQLEPLCCYLSELSILDYKT-VKFVPSLLAASAVFLARFIIRP 299

  Fly   394 EM--WTPRLEEITTYKLEDLKTVV--LHLCHTHKTAKELNTQAMREKYNRDTYKKVAMM 448
            :.  |...|||.|.||..||:..|  :|..:..:....|  ||:||||....::.||.|
plant   300 KQHPWNQMLEEYTKYKAADLQVCVGIIHDLYLSRRGGAL--QAVREKYKHHKFQCVATM 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 70/129 (54%)
Cyclin_C 334..450 CDD:281044 40/125 (32%)
CYCA3;2NP_564499.3 Cyclin_N 105..234 CDD:278560 70/129 (54%)
Cyclin_C 236..359 CDD:281044 40/125 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I1330
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoInspector 1 1.000 T124214
orthoMCL 1 0.900 OOG5_126649
Panther 1 1.100 O PTHR10177
Phylome 1 0.910 0.600 Consistency score
65.970

Return to query results.
Submit another query.