DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCB1;5

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001320187.1 Gene:CYCB1;5 AraportID:AT1G34460 Length:498 Species:Arabidopsis thaliana

Alignment Length:443 Identity:112/444 (25%)
Similarity:179/444 (40%) Gaps:142/444 (32%)


  Fly    17 GIKIP---AGVKNTKQ----------PLAVIGGKAEKNALAP-----RANFAV--------LNGN 55
            |:||.   ..|||.:.          | .|.||||:.....|     ||....        :||:
plant   131 GLKIQNKNGAVKNRRALGDIGNLVSVP-GVQGGKAQPPINRPITLSFRAQLLANAQLERKPINGD 194

  Fly    56 NNVPRPAGKVQVFRDVRNLNVDENVEYGAKKSNVVPVVEQFKTFSVYEDNNDTQVAPSGKSLASL 120
            |.||....|.|... .||......|:    |.|:| |.:|.|...|.|...:.|    .|:...:
plant   195 NKVPALGPKSQPLA-ARNPEAQRAVQ----KKNLV-VKQQTKPVEVIETKRNAQ----SKAACGI 249

  Fly   121 VDKENHDVKFGAGQKELVDYDLDSTPMSVTDVQSPMSVDRSILGVIQSSDISVGTETGVSPTGRV 185
            |:|           .:::|.|                                            
plant   250 VNK-----------PKILDID-------------------------------------------- 259

  Fly   186 KELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEY 250
                 .:|:...:..|:|..|:..:::|.||:.:|| :||..|.:::..||:||||||:||..::
plant   260 -----ESDKDNHVAAVEYVDDMYSFYKEVEKESQPK-MYMHIQTEMNEKMRAILIDWLLEVHIKF 318

  Fly   251 KLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQ 315
            :|:.|||||:|..:||||...||.:.:||                    |.:.|::||::|:..|
plant   319 ELNLETLYLTVNIIDRFLYVKAVPKRELQ--------------------VNDLVYVTDNAYSSRQ 363

  Fly   316 VLRMEQVILKILSFDLCTPTAYVFINTY--AVLCDMPE------------KLKYMTLYI----SE 362
            :|.|::.||..|.:.|..||.|||:..:  |.:.| ||            |.|..::.:    |.
plant   364 ILVMKKAILGNLEWYLTIPTQYVFLFCFIKASISD-PEVLHVQKKNLQASKTKSFSIQVLSFSSH 427

  Fly   363 LSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYKLEDLKTVV 415
            .|:::.:.:.:.........::|...|:...|.|.   |.:|  ||:|.:|.|
plant   428 KSIVKSDQFCKKFNLCQEVTALASEFHLGNCEAWR---ETVT--KLKDPETKV 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 46/126 (37%)
Cyclin_C 334..450 CDD:281044 24/101 (24%)
CYCB1;5NP_001320187.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126649
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.