DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCB2;3

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_173485.1 Gene:CYCB2;3 AraportID:AT1G20610 Length:429 Species:Arabidopsis thaliana

Alignment Length:356 Identity:112/357 (31%)
Similarity:178/357 (50%) Gaps:33/357 (9%)


  Fly   115 KSLASLVDKENH----DVK----FGAGQKELVDYDLDSTPMSVTDVQSPMSVD--RSILGVIQSS 169
            |..|.|.|.:.|    :.|    ..:.:.|.:..|:|.:.....|...||.|.  .::|..|:..
plant    80 KFAAQLADHKPHIRDEETKKPDSVSSEEPETIIIDVDESDKEGGDSNEPMFVQHTEAMLEEIEQM 144

  Fly   170 DISVGTETGVSPTGRVKELPP-----RNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQK 229
            :..:..|..      .||..|     ..|:...|..|:|..|:..:::..||.....|.||..|:
plant   145 EKEIEMEDA------DKEEEPVIDIDACDKNNPLAAVEYIHDMHTFYKNFEKLSCVPPNYMDNQQ 203

  Fly   230 DISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEE 294
            |::..||.||||||:||..:::|..|||||::..:||||:...:||.||||||..|:.:|.||||
plant   204 DLNERMRGILIDWLIEVHYKFELMEETLYLTINVIDRFLAVHQIVRKKLQLVGVTALLLACKYEE 268

  Fly   295 IYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLY 359
            :..|.|.:.:.::|.:|::.:||.||:::...|.|:...||.|||:..:.......:||:.::.:
plant   269 VSVPVVDDLILISDKAYSRREVLDMEKLMANTLQFNFSLPTPYVFMKRFLKAAQSDKKLEILSFF 333

  Fly   360 ISELSLMEGETYLQYLPSLMSSASVALARHIL-GMEMWTPRLEEITTYKLEDL-----KTVVLHL 418
            :.||.|:|.| .|:||||.::::::..|:..| |.|.|:...|..|.|..:.|     |.|..| 
plant   334 MIELCLVEYE-MLEYLPSKLAASAIYTAQCTLKGFEEWSKTCEFHTGYNEKQLLACARKMVAFH- 396

  Fly   419 CHTHKTAKELNTQAMREKYNRDTYKKVAMME 449
             |...|.|   ...:..|||...:...|..|
plant   397 -HKAGTGK---LTGVHRKYNTSKFCHAARTE 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 52/126 (41%)
Cyclin_C 334..450 CDD:281044 37/123 (30%)
CYCB2;3NP_173485.1 Cyclin_N 180..304 CDD:278560 52/124 (42%)
Cyclin_C 308..425 CDD:281044 37/123 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126649
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.