DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCB3;1

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_173083.3 Gene:CYCB3;1 AraportID:AT1G16330 Length:648 Species:Arabidopsis thaliana

Alignment Length:459 Identity:132/460 (29%)
Similarity:218/460 (47%) Gaps:60/460 (13%)


  Fly    26 NTKQPLAVIGGKAEKNALAPRANFA--------------VLNGN----NNV--PRPAGKVQ--VF 68
            |:||....:..||...|: |:.:.|              ..:||    |||  .|.:.|:|  |.
plant   214 NSKQLGQGLASKASNQAV-PQLSSAGTYTWKTRTSVGSIQSDGNKQSKNNVRFVRKSIKIQTTVK 277

  Fly    69 RDVRNLNVDENVEYGAKKS---NVVPVVEQFKTFSVYED------NNDTQVAPSGKSLASLVDKE 124
            ..::|.:..:....|..||   :.:|......|.|:.|.      ..|||    |:|.:|     
plant   278 TSLQNRSSLKKPPVGRSKSRSISSIPSSAVASTLSLPEKVETKCLEEDTQ----GESSSS----- 333

  Fly   125 NHDVKFGAGQKELVDYDLDSTPMSVTDVQSPMSVDRSILGVIQSSDISVGTETGVSPTGRVKELP 189
                    |.|:.....||.|       ..|.|..|.....:..:......:.|  .|...::||
plant   334 --------GNKDPTTKVLDVT-------AKPKSKRRKSFTSLLVNGSKFDEKNG--ETTEPEKLP 381

  Fly   190 PRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDT 254
            ..:|....|||.:|..||.:::..:|..:.....|:....::|...|.|||:||:||..::.|..
plant   382 SIDDESNQLEVAEYVDDIYQFYWTAEALNPALGHYLSAHAEVSPVTRGILINWLIEVHFKFDLMH 446

  Fly   255 ETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRM 319
            |||||::..|||:|||:.:.::::||:|..|:.:|:|||:.:.|.:.:.:.::.:|||:.|:|.|
plant   447 ETLYLTMDLLDRYLSQVPIHKNEMQLIGLTALLLASKYEDYWHPRIKDLISISAESYTREQILGM 511

  Fly   320 EQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASV 384
            |:.:||.|.|.|..||.|||:..:.......:||:.:..|:.||.|:|.|. |:|.|||:.::::
plant   512 ERSMLKQLKFRLNAPTPYVFMLRFLKAAQSNKKLEQLAFYLIELCLVEYEA-LKYKPSLLCASAI 575

  Fly   385 ALARHILGM-EMWTPRLEEITTYKLEDLKTVVLHLCHTHKTAKELNTQAMREKYNRDTYKKVAMM 448
            .:||..|.| .:||..|...|.|.:..:|.....:...||.||..|.:...|||.......||::
plant   576 YVARCTLHMTPVWTSLLNNHTHYNVSQMKDCSDMILRFHKAAKTGNLRVTYEKYINPDRSNVAVL 640

  Fly   449 ESVE 452
            :.::
plant   641 KPLD 644

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 46/126 (37%)
Cyclin_C 334..450 CDD:281044 38/117 (32%)
CYCB3;1NP_173083.3 Cyclin_N 398..524 CDD:278560 46/126 (37%)
Cyclin_C 526..643 CDD:281044 38/118 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.