DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCA2;3

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_173010.1 Gene:CYCA2;3 AraportID:AT1G15570 Length:450 Species:Arabidopsis thaliana

Alignment Length:396 Identity:132/397 (33%)
Similarity:200/397 (50%) Gaps:61/397 (15%)


  Fly   109 QVAPSGKSLASLVDKENHDVKFGAGQKELVDYDLDSTPM-------SVTDVQS----PMSVDRSI 162
            ::.....:.|.|..|.:..:|.|.|      :.|.||..       .|||:||    .:.|..:.
plant    60 EITNVNSNTAILEAKNSKQIKKGRG------HGLASTSQLATSVTSEVTDLQSRTDAKVEVASNT 118

  Fly   163 LGVIQSSDISVGTETGVSPTGRV--KELPPR--------------------NDRQRFLEV----- 200
            .|   :..:|.||:........:  ..||||                    .|..:|:::     
plant   119 AG---NLSVSKGTDNTADNCIEIWNSRLPPRPLGRSASTAEKSAVIGSSTVPDIPKFVDIDSDDK 180

  Fly   201 -----VQYQMDILEYFRESEKKHRPKPLYMRR-QKDISHNMRSILIDWLVEVSEEYKLDTETLYL 259
                 ..|..:|....|.||.|.||.|.:|.| |||::.:||.||:||||||||||.|.::||||
plant   181 DPLLCCLYAPEIHYNLRVSELKRRPLPDFMERIQKDVTQSMRGILVDWLVEVSEEYTLASDTLYL 245

  Fly   260 SVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVIL 324
            :|:.:|.||....|.|.:|||:|...|.||:|||||..|.:.||.|:||::||:.|||.||..:|
plant   246 TVYLIDWFLHGNYVQRQQLQLLGITCMLIASKYEEISAPRIEEFCFITDNTYTRDQVLEMENQVL 310

  Fly   325 KILSFDLCTPTAYVFINTY-----AVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASV 384
            |..||.:.|||...|:..:     |.......:::::..|::||:|::.. :|::|||::::::|
plant   311 KHFSFQIYTPTPKTFLRRFLRAAQASRLSPSLEVEFLASYLTELTLIDYH-FLKFLPSVVAASAV 374

  Fly   385 ALARHILGM--EMWTPRLEEITTYKLEDLKTVVLHLCHTHKTAKELNTQAMREKYNRDTYKKVAM 447
            .||:..:..  ..|.|.||..||||..|||..|..|.......|.....|:|.||.::.||.||:
plant   375 FLAKWTMDQSNHPWNPTLEHYTTYKASDLKASVHALQDLQLNTKGCPLSAIRMKYRQEKYKSVAV 439

  Fly   448 MESVEM 453
            :.|.::
plant   440 LTSPKL 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 67/127 (53%)
Cyclin_C 334..450 CDD:281044 37/123 (30%)
CYCA2;3NP_173010.1 Cyclin_N 191..317 CDD:278560 67/126 (53%)
Cyclin_C 320..443 CDD:281044 38/124 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H55562
Inparanoid 1 1.050 192 1.000 Inparanoid score I1330
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoInspector 1 1.000 T124214
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10177
Phylome 1 0.910 0.600 Consistency score
66.070

Return to query results.
Submit another query.