DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCA2;1

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001332473.1 Gene:CYCA2;1 AraportID:AT5G25380 Length:443 Species:Arabidopsis thaliana

Alignment Length:446 Identity:144/447 (32%)
Similarity:216/447 (48%) Gaps:65/447 (15%)


  Fly    39 EKNALAPRANFAVLNGNNNVPRPAGKVQVFRDVRNLNVDENVEYGAKK--SNVVPVVEQFKTFSV 101
            :.|....|:....|..:|:..:||.|.:..|..|..|         |:  |:.:.|..| |..:|
plant    23 DNNVRVTRSRAKALGVSNSPSKPAFKHETKRVARPSN---------KRMASDNITVCNQ-KRRAV 77

  Fly   102 YEDNNDTQVAPSGKSLA-SLVDKENHDVKFGAGQKELVDYDLDSTPMSVTDVQSPMSVDRSILGV 165
            .:|..:|        || |::..|.:......|.||....:.|.. :.|...:|.::.|.|.:.:
plant    78 LKDVTNT--------LAESIISTEGNVKACKRGGKETKQIEEDGL-VDVDGEKSKLAEDLSKIRM 133

  Fly   166 IQSSDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQ----------------YQMDILEYFRES 214
            ::|.|.|...:..|...        ..||....:.||                |...|.:....:
plant   134 VESLDASASKQKLVDCA--------EEDRSDVTDCVQIVDIDSGVQDPQFCSLYAASIYDSINVA 190

  Fly   215 EKKHRPKPLYM-RRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKL 278
            |.:.||...|| :.|:||...||.|||||||||||||||.::||||:|..:|||:|...:.:.||
plant   191 ELEQRPSTSYMVQVQRDIDPTMRGILIDWLVEVSEEYKLVSDTLYLTVNLIDRFMSHNYIEKQKL 255

  Fly   279 QLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTY 343
            ||:|...|.||:|||||..|.:.||.|:||::||:.:||.||..:|..|.|.|..||...|:..:
plant   256 QLLGITCMLIASKYEEISAPRLEEFCFITDNTYTRLEVLSMEIKVLNSLHFRLSVPTTKTFLRRF 320

  Fly   344 AVLCDMPEK-----LKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGM--EMWTPRLE 401
            .......:|     ::|:..|.:||:|.| .|:|::||||:::::|.|||..|..  ..|...|:
plant   321 IRAAQASDKVPLIEMEYLANYFAELTLTE-YTFLRFLPSLIAASAVFLARWTLDQSNHPWNQTLQ 384

  Fly   402 EITTYKLEDLKTVVLHLCHTHKTAKELNTQ-----AMREKYNRDTYKKVAMMESVE 452
            ..|.|:...||..||.:     ...:|||.     |:..|||:..:|:||.:.|.|
plant   385 HYTRYETSALKNTVLAM-----EELQLNTSGSTLIAIHTKYNQQKFKRVATLTSPE 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 64/127 (50%)
Cyclin_C 334..450 CDD:281044 39/128 (30%)
CYCA2;1NP_001332473.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I1330
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoInspector 1 1.000 T124214
orthoMCL 1 0.900 OOG5_126649
Panther 1 1.100 O PTHR10177
Phylome 1 0.910 0.600 Consistency score
65.970

Return to query results.
Submit another query.