DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCD4;2

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_196606.3 Gene:CYCD4;2 AraportID:AT5G10440 Length:298 Species:Arabidopsis thaliana

Alignment Length:200 Identity:59/200 (30%)
Similarity:101/200 (51%) Gaps:27/200 (14%)


  Fly   206 DILEYFRESEKKHRPKPLYMRRQK--DISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFL 268
            :|:....|.|::|.|:..|::|.:  |:..|:|...:.|:.:..||.:.....:.|::.||||||
plant    37 EIVREMIEKERQHSPRDDYLKRLRNGDLDFNVRIQALGWIWKACEELQFGPLCICLAMNYLDRFL 101

  Fly   269 SQMAVVRSK---LQLVGTAAMYIAAKYEEIYPPE-----VGEFVFLTDDSYTKAQVLRMEQVILK 325
            |...:...|   :||:..|.:.:|||.||...||     ||..:|:    :....|.|||.::|.
plant   102 SVHDLPSGKAWTVQLLAVACLSLAAKIEETNVPELMQLQVGAPMFV----FEAKSVQRMELLVLN 162

  Fly   326 ILSFDL--CTPTAYV-----FINTYAVLCDMPEKLKYMTLYISEL-SLMEGETYLQYLPSLMSSA 382
            :|.:.|  .||.:||     .||.|    |.....:.:|..:..: |..:|..:|::..|.: :|
plant   163 VLRWRLRAVTPCSYVRYFLSKINGY----DQEPHSRLVTRSLQVIASTTKGIDFLEFRASEI-AA 222

  Fly   383 SVALA 387
            :|||:
plant   223 AVALS 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 42/138 (30%)
Cyclin_C 334..450 CDD:281044 16/60 (27%)
CYCD4;2NP_196606.3 Cyclin_N 37..169 CDD:278560 42/136 (31%)
Cyclin_C 171..281 CDD:281044 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10177
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.