DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYC1BAT

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_196233.1 Gene:CYC1BAT AraportID:AT5G06150 Length:445 Species:Arabidopsis thaliana

Alignment Length:435 Identity:138/436 (32%)
Similarity:216/436 (50%) Gaps:74/436 (17%)


  Fly    33 VIGGKAEKNALAP-----RANFAV--------LNGNNNVPRPAGKVQVFRDVRNLNVDENVEYGA 84
            |.||||:.....|     ||....        :||:|.||....|.|... .||......|:   
plant    47 VQGGKAQPPINRPITRSFRAQLLANAQLERKPINGDNKVPALGPKRQPLA-ARNPEAQRAVQ--- 107

  Fly    85 KKSNVVPVVEQFKTFSVYEDNNDT---QVAPSGKSLASLVDKENHDVKFGAGQKELVDYDLDSTP 146
             |.|:| |.:|.|...|.|...:.   :||.|.|:                   :.|.|.     
plant   108 -KKNLV-VKQQTKPVEVIETKKEVTKKEVAMSPKN-------------------KKVTYS----- 146

  Fly   147 MSVTDVQSPMSVDRSILGVIQSSDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYF 211
             ||...:|     ::..|::....|....|               :|:...|..|:|..|:..::
plant   147 -SVLSARS-----KAACGIVNKPKIIDIDE---------------SDKDNHLAAVEYVDDMYSFY 190

  Fly   212 RESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRS 276
            :|.||:.:|| :||..|.:::..||:||||||:||..:::|:.|||||:|..:|||||..||.:.
plant   191 KEVEKESQPK-MYMHIQTEMNEKMRAILIDWLLEVHIKFELNLETLYLTVNIIDRFLSVKAVPKR 254

  Fly   277 KLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFIN 341
            :|||||.:|:.||:|||||:||:|.:.|::||::|:..|:|.||:.||..|.:.|..||.|||:.
plant   255 ELQLVGISALLIASKYEEIWPPQVNDLVYVTDNAYSSRQILVMEKAILGNLEWYLTVPTQYVFLV 319

  Fly   342 TY--AVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGME-MWTPRLEEI 403
            .:  |.:.| || ::.|..:::||.:|..:| |.:.||::::::|..||..|... .||..|:..
plant   320 RFIKASMSD-PE-MENMVHFLAELGMMHYDT-LTFCPSMLAASAVYTARCSLNKSPAWTDTLQFH 381

  Fly   404 TTYKLEDLKTVVLHLCHTHKTAKELNTQAMREKYNRDTYKKVAMM 448
            |.|...::......|...|....|...:|:.:||::.....|||:
plant   382 TGYTESEIMDCSKLLAFLHSRCGESRLRAVYKKYSKAENGGVAMV 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 61/126 (48%)
Cyclin_C 334..450 CDD:281044 35/119 (29%)
CYC1BATNP_196233.1 COG5024 4..424 CDD:227357 136/432 (31%)
Cyclin_N 185..310 CDD:278560 61/126 (48%)
Cyclin_C 312..429 CDD:281044 35/119 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126649
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.