DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCD5;1

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_195478.2 Gene:CYCD5;1 AraportID:AT4G37630 Length:323 Species:Arabidopsis thaliana

Alignment Length:320 Identity:68/321 (21%)
Similarity:119/321 (37%) Gaps:87/321 (27%)


  Fly   191 RNDRQ--RFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLD 253
            |:|:|  .|...:..:..:.:...:...:....|     .|..|.:.|.|.|||::.....:...
plant    30 RSDKQEPHFTTTIDDEDYVADLVLKENLRFETLP-----SKTTSSSDRLIAIDWILTTRTRFGFQ 89

  Fly   254 TETLYLSVFYLDRFLSQMAVVRSK-----LQLVGTAAMYIAAKYEE-IYP-----PEVGEFVFLT 307
            .:|.|:::.|.|.||.:..:...|     ::|:..|.:.:|||.|| |.|     |:..:|||  
plant    90 HQTAYIAISYFDLFLHKRFIGLQKDETWAMRLLSVACLSLAAKMEERIVPGLSQYPQDHDFVF-- 152

  Fly   308 DDSYTKAQVLR-MEQVILKILSFDLCTPTAYVFINTY--------------AVLCDMPEKLKYMT 357
                 |..|:| .|.:||..|.:.:...|.:.:.|.:              .||....:.|..:|
plant   153 -----KPDVIRKTELLILSTLDWKMNLITPFHYFNYFLAKISQDNHSVSKDLVLLRSSDSLLALT 212

  Fly   358 LYISELSLMEGETYLQY--------LPSLMSSASVALARHIL-----GMEMWTPRLEEITTYKLE 409
               .|:|..|   |.|:        |.|..:|:.:.|.|..:     .:..||....|       
plant   213 ---KEISFTE---YRQFVVAAVTTLLASSSTSSDIRLTREEIANKFGSISWWTSNENE------- 264

  Fly   410 DLKTVVLHLCHTHKTAKELNTQAMREKYNRDTYKKVAMMESV---------EMSKDDFDQ 460
                 .::||:.       .|..:.|:.:.....::|:....         .:|.||.||
plant   265 -----NVYLCYQ-------RTLEIEERKHMTPPPEIAVSREPPASGSGAKRRLSFDDSDQ 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 35/138 (25%)
Cyclin_C 334..450 CDD:281044 24/143 (17%)
CYCD5;1NP_195478.2 Cyclin_N <72..173 CDD:278560 32/108 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10177
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.