DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCB1;1

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_195465.1 Gene:CYCB1;1 AraportID:AT4G37490 Length:428 Species:Arabidopsis thaliana

Alignment Length:446 Identity:135/447 (30%)
Similarity:216/447 (48%) Gaps:74/447 (17%)


  Fly    31 LAVIGGK-----AEKNALAPRANFAVLNGN---NNVP-----RPAGKVQVFRDVRNLNVDENVEY 82
            :.|:.||     ..:..|....|  |:.||   ||.|     ||..:.|    ...|.|::|::.
plant    16 VVVVDGKNVAKGRNRQVLGDIGN--VVRGNYPKNNEPEKINHRPRTRSQ----NPTLLVEDNLKK 74

  Fly    83 GAKKSNVVP----VVEQFKTFSVYEDNNDTQVAPSGKSLASLVDKENHDVKFGAGQKELVDYDLD 143
            ...|.|.||    |..:.|...|.|.::|     |.:.|..:..:|..     |.:|:...|...
plant    75 PVVKRNAVPKPKKVAGKPKVVDVIEISSD-----SDEELGLVAAREKK-----ATKKKATTYTSV 129

  Fly   144 STPMS-----VTDVQSPMSVDRSILGVIQSSDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQY 203
            .|..|     :...|....||      |.|:|:                   .||    |..|:|
plant   130 LTARSKAACGLEKKQKEKIVD------IDSADV-------------------END----LAAVEY 165

  Fly   204 QMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFL 268
            ..||..:::..|.:.||:. ||..|.||:..||.||::||::|...::|:.||.||:|..|||||
plant   166 VEDIYSFYKSVESEWRPRD-YMASQPDINEKMRLILVEWLIDVHVRFELNPETFYLTVNILDRFL 229

  Fly   269 SQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCT 333
            |...|.|.:|||||.:|:.::||||||:||:|.:.|.:.|.:|:..|:|.||:.||..|.:.|..
plant   230 SVKPVPRKELQLVGLSALLMSAKYEEIWPPQVEDLVDIADHAYSHKQILVMEKTILSTLEWYLTV 294

  Fly   334 PTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHIL-GMEMWT 397
            ||.|||:..:.......||::.|..|::||.:|..:|.:.:.||:::::::..||..| .:.:||
plant   295 PTHYVFLARFIKASIADEKMENMVHYLAELGVMHYDTMIMFSPSMVAASAIYAARSSLRQVPIWT 359

  Fly   398 PRLEEITTYK----LEDLKTVVLHLCHTHKTAKELNTQ-AMREKYNRDTYKKVAMM 448
            ..|:..|.|.    ::..|.:........:...|.:|: |:|:||::|....||::
plant   360 STLKHHTGYSETQLMDCAKLLAYQQWKQQEEGSESSTKGALRKKYSKDERFAVALI 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 57/126 (45%)
Cyclin_C 334..450 CDD:281044 33/122 (27%)
CYCB1;1NP_195465.1 Cyclin_N 168..293 CDD:278560 57/126 (45%)
Cyclin_C 295..418 CDD:281044 33/122 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126649
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.