DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCB2;2

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_195287.1 Gene:CYCB2;2 AraportID:AT4G35620 Length:429 Species:Arabidopsis thaliana

Alignment Length:355 Identity:110/356 (31%)
Similarity:179/356 (50%) Gaps:31/356 (9%)


  Fly   100 SVYEDNNDT-QVAPSGKSLAS--LVDKENHDVKFGAGQKELVDYDLDSTPMSVTDVQ---SPMSV 158
            |:.....:| ::.|||.....  .:|:|..       :.|.|..| ...|||:.:..   .||..
plant    84 SISRSQEETKKLKPSGNEFGDCIFIDEEEE-------KNEEVTLD-QPMPMSLEEPYIEFDPMEE 140

  Fly   159 DRSILGVIQSSDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPL 223
            :      ::..|:.   |....|...:.|....|.    |..|:|..|:.:::|::| :....||
plant   141 E------VEMEDME---EEQEEPVLDIDEYDANNS----LAAVEYVQDLYDFYRKTE-RFSCVPL 191

  Fly   224 -YMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMY 287
             ||.:|.|||..||:||||||:||.::::|..|||:|:|..:|||||:.||.|.||||||..|:.
plant   192 DYMAQQFDISDKMRAILIDWLIEVHDKFELMNETLFLTVNLIDRFLSKQAVARKKLQLVGLVALL 256

  Fly   288 IAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEK 352
            :|.||||:..|.|.:.|.::|.:||:..||.||:::|..|.|::..||.|.|:..:.......:|
plant   257 LACKYEEVSVPIVEDLVVISDKAYTRTDVLEMEKIMLSTLQFNMSLPTQYPFLKRFLKAAQSDKK 321

  Fly   353 LKYMTLYISELSLMEGETYLQYLPSLMSSASVALAR-HILGMEMWTPRLEEITTYKLEDLKTVVL 416
            |:.:..::.||:|::.| .::|.|||:::.:|..|: .|.|...|....|....|....|.....
plant   322 LEILASFLIELALVDYE-MVRYPPSLLAATAVYTAQCTIHGFSEWNSTCEFHCHYSENQLLECCR 385

  Fly   417 HLCHTHKTAKELNTQAMREKYNRDTYKKVA 446
            .:...|:.|.......:..||:...:..:|
plant   386 RMVRLHQKAGTDKLTGVHRKYSSSKFGYIA 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 60/127 (47%)
Cyclin_C 334..450 CDD:281044 27/115 (23%)
CYCB2;2NP_195287.1 Cyclin_N 175..301 CDD:278560 60/127 (47%)
Cyclin_C 303..416 CDD:281044 27/115 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126649
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.