DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCD3;1

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_195142.1 Gene:CYCD3;1 AraportID:AT4G34160 Length:376 Species:Arabidopsis thaliana

Alignment Length:286 Identity:66/287 (23%)
Similarity:117/287 (41%) Gaps:64/287 (22%)


  Fly   236 RSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSK---LQLVGTAAMYIAAKYEEIYP 297
            |...:.|::.|:..|...|....|::.|||:|:...::.|.|   ||||..|.:.:|||.||...
plant    87 RKEAVGWILRVNAHYGFSTLAAVLAITYLDKFICSYSLQRDKPWMLQLVSVACLSLAAKVEETQV 151

  Fly   298 PEVGEF-VFLTDDSYTKAQVLRMEQVILKILSF--DLCTPTAYV----------------FINTY 343
            |.:.:| |..|...:....:.|||.:||..|.:  .|.||.::|                |:|..
plant   152 PLLLDFQVEETKYVFEAKTIQRMELLILSTLEWKMHLITPISFVDHIIRRLGLKNNAHWDFLNKC 216

  Fly   344 AVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTP-----RLEEI 403
            ..|.               ||::....::.||||::::|:  :.|.|..::.:.|     .|..:
plant   217 HRLL---------------LSVISDSRFVGYLPSVVAAAT--MMRIIEQVDPFDPLSYQTNLLGV 264

  Fly   404 TTYKLEDLKT---VVLHLCHTHKTAKELNTQAMREKYNRDTYKKVAM---------MESVEMSKD 456
            .....|.:||   ::|.| ...:...::..|:.:::.:.|:...:..         ..|.|.|.|
plant   265 LNLTKEKVKTCYDLILQL-PVDRIGLQIQIQSSKKRKSHDSSSSLNSPSCVIDANPFNSDESSND 328

  Fly   457 DFDQLCEAYNCK---QKEDEHQQPDI 479
            .:    .|.:|.   ......|||.:
plant   329 SW----SASSCNPPTSSSSPQQQPPL 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 33/102 (32%)
Cyclin_C 334..450 CDD:281044 23/149 (15%)
CYCD3;1NP_195142.1 Cyclin_N <87..186 CDD:278560 32/99 (32%)
Cyclin_C 190..>282 CDD:281044 21/109 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10177
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.