DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCD3;3

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_190576.1 Gene:CYCD3;3 AraportID:AT3G50070 Length:361 Species:Arabidopsis thaliana

Alignment Length:216 Identity:52/217 (24%)
Similarity:97/217 (45%) Gaps:39/217 (18%)


  Fly   236 RSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSK---LQLVGTAAMYIAAKYEEIYP 297
            |...:||:.:|...|..::.|..|:|.|.|||::.......|   .||...|.:.:|||.|||..
plant    86 REKALDWIFKVKSHYGFNSLTALLAVNYFDRFITSRKFQTDKPWMSQLTALACLSLAAKVEEIRV 150

  Fly   298 PEVGEFVFLTDDSYTKAQ-------VLRMEQVILKILSFDL--CTPTAYV--FINTYAVLCDMPE 351
            |      ||.|....:|:       :.|||.::|..|.:.:  .||.::.  .|..|:.      
plant   151 P------FLLDFQVEEARYVFEAKTIQRMELLVLSTLDWRMHPVTPISFFDHIIRRYSF------ 203

  Fly   352 KLKYMTLYISE-----LSLMEGETYLQYLPSLMSSA-SVALARHILGMEMWTPRLEEITTYKLED 410
            |..:...::|.     ||::....:|.:.||::::| .|::.|.:...:....:.:.:|..|::.
plant   204 KSHHQLEFLSRCESLLLSIIPDSRFLSFSPSVLATAIMVSVIRDLKMCDEAVYQSQLMTLLKVDS 268

  Fly   411 LKTVVLHLCH----THKTAKE 427
            .|   ::.|:    .|..:|:
plant   269 EK---VNKCYELVLDHSPSKK 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 32/108 (30%)
Cyclin_C 334..450 CDD:281044 19/107 (18%)
CYCD3;3NP_190576.1 Cyclin_N <86..185 CDD:278560 32/105 (30%)
Cyclin_C 188..298 CDD:281044 20/109 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10177
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.