DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCB1;3

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_187759.2 Gene:CYCB1;3 AraportID:AT3G11520 Length:414 Species:Arabidopsis thaliana

Alignment Length:439 Identity:128/440 (29%)
Similarity:199/440 (45%) Gaps:70/440 (16%)


  Fly     9 DMSNKENPGIKIPAGVKNTKQPLAVIGGKAEKNALAPRANFAVLNGNNNVPRPAGKVQVFRDVRN 73
            |:.|......:....:.|....:.|.|||              ||      ||.        .||
plant    18 DLKNAAAKNRRALGDIGNVDSLIGVEGGK--------------LN------RPI--------TRN 54

  Fly    74 LNVD--ENVEYGAKKSNVVPVVE-----QFKTFSVYEDNNDTQVAPSGKSLASLVDKENHDVKFG 131
            ....  ||.:..|..:...|:::     |....:|.:.....:..||......::..:.::|...
plant    55 FRAQLLENAQVAAAANKKAPILDGVTKKQEVVRAVQKKARGDKREPSKPIEVIVISPDTNEVAKA 119

  Fly   132 AGQKELVDYDLDSTPMSVTDVQSPMSVDRSILGVIQSSDISVGTETGVSPTGRVKELPPRNDRQR 196
            ...|:.|.|.      ||.|.:|                      ...|.|..:..:...||   
plant   120 KENKKKVTYS------SVLDARS----------------------KAASKTLDIDYVDKEND--- 153

  Fly   197 FLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSV 261
             |..|:|..|:..:::|...:.:|: :||..|.:|...||||||||||||..::.|..|||||:|
plant   154 -LAAVEYVEDMYIFYKEVVNESKPQ-MYMHTQPEIDEKMRSILIDWLVEVHVKFDLSPETLYLTV 216

  Fly   262 FYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKI 326
            ..:|||||...|.|.:|||||.:|:.||:|||||:||:|.:.|::||:||...|:|.||:.||..
plant   217 NIIDRFLSLKTVPRRELQLVGVSALLIASKYEEIWPPQVNDLVYVTDNSYNSRQILVMEKTILGN 281

  Fly   327 LSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHIL 391
            |.:.|..||.|||:..:.......:||:.:..:::||.||..:: |.:.||::::::|..||..|
plant   282 LEWYLTVPTQYVFLVRFIKASGSDQKLENLVHFLAELGLMHHDS-LMFCPSMLAASAVYTARCCL 345

  Fly   392 G-MEMWTPRLEEITTYKLEDLKTVVLHLCHTHKTAKELNTQAMREKYNR 439
            . ...||..|:..|.|....|......|...|..|.|...:.:.:||::
plant   346 NKTPTWTDTLKFHTGYSESQLMDCSKLLAFIHSKAGESKLRGVLKKYSK 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 62/126 (49%)
Cyclin_C 334..450 CDD:281044 30/108 (28%)
CYCB1;3NP_187759.2 Cyclin_N 162..287 CDD:278560 62/126 (49%)
Cyclin_C 289..406 CDD:281044 30/108 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126649
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.