DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCB1;4

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_180244.1 Gene:CYCB1;4 AraportID:AT2G26760 Length:387 Species:Arabidopsis thaliana

Alignment Length:274 Identity:103/275 (37%)
Similarity:159/275 (58%) Gaps:11/275 (4%)


  Fly   193 DRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETL 257
            |....|..|:|..||.:::|..|::...|. |:..|.:|:..||||||||||:|..:::|..|||
plant   120 DANNELAAVEYVEDIFKFYRTVEEEGGIKD-YIGSQPEINEKMRSILIDWLVDVHRKFELMPETL 183

  Fly   258 YLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQV 322
            ||::..:|||||...|.|.:|||:|..||.||.|||||:.|||.:||.::|::|.:.|||.||:.
plant   184 YLTINLVDRFLSLTMVHRRELQLLGLGAMLIACKYEEIWAPEVNDFVCISDNAYNRKQVLAMEKS 248

  Fly   323 ILKILSFDLCTPTAYVFINTY---AVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASV 384
            ||..:.:.:..||.|||:..|   ||.||  .:::.:..|::||.||:....:...||::::::|
plant   249 ILGQVEWYITVPTPYVFLARYVKAAVPCD--AEMEKLVFYLAELGLMQYPIVVLNRPSMLAASAV 311

  Fly   385 ALARHIL-GMEMWTPRLEEITTYKLEDLKTVVLHLCHTHKTAKELNTQAMREKYNRDTYKKVAMM 448
            ..||.|| ....||..|:..|.|..:::......|.....:|.|....|:.:||:.....:||::
plant   312 YAARQILKKTPFWTETLKHHTGYSEDEIMEHAKMLMKLRDSASESKLIAVFKKYSVSENAEVALL 376

  Fly   449 ESVEMSKDDFDQLC 462
            .|:    |||...|
plant   377 PSL----DDFSVSC 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 59/126 (47%)
Cyclin_C 334..450 CDD:281044 35/120 (29%)
CYCB1;4NP_180244.1 Cyclin_N 133..258 CDD:278560 59/126 (47%)
Cyclin_C 260..379 CDD:281044 36/121 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.