DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and CYCD2;1

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001189576.1 Gene:CYCD2;1 AraportID:AT2G22490 Length:362 Species:Arabidopsis thaliana

Alignment Length:395 Identity:80/396 (20%)
Similarity:162/396 (41%) Gaps:86/396 (22%)


  Fly   120 LVDKENHDVKFGAGQKELVDYDLDSTPMSVTDVQSPMSVDRSILGVIQSSDISVGTETGVSPTGR 184
            ::|.::.|:.:|.|....:||:           ....:.|.:..|  ..|...:|:.:......|
plant    15 IIDNDDDDINYGGGFTNEIDYN-----------HQLFAKDDNFGG--NGSIPMMGSSSSSLSEDR 66

  Fly   185 VKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRR--QKDISHNMRSILIDWLVEVS 247
            :||:..|                       |.:..|...|::|  ..|:..::|:..:||:::|.
plant    67 IKEMLVR-----------------------EIEFCPGTDYVKRLLSGDLDLSVRNQALDWILKVC 108

  Fly   248 EEYKLDTETLYLSVFYLDRFLSQMAVVRSK---LQLVGTAAMYIAAKYEEIYPPEV-------GE 302
            ..|......:.||:.||||||:...:.:.|   .||:..:.:.:|:|.||...|.:       .:
plant   109 AHYHFGHLCICLSMNYLDRFLTSYELPKDKDWAAQLLAVSCLSLASKMEETDVPHIVDLQVEDPK 173

  Fly   303 FVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYA--VLCDMPEKLKY-MTLYISELS 364
            |||   ::.|   :.|||.:::..|::.|...|.:.||:.:.  :...:.|.|.| .:.:|  |:
plant   174 FVF---EAKT---IKRMELLVVTTLNWRLQALTPFSFIDYFVDKISGHVSENLIYRSSRFI--LN 230

  Fly   365 LMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHLCHTHKTAKELN 429
            ..:...:|.:.||.:::|: |::..|.|.   |..::|      |...:.::::....:..:.||
plant   231 TTKAIEFLDFRPSEIAAAA-AVSVSISGE---TECIDE------EKALSSLIYVKQQERVKRCLN 285

  Fly   430 TQAMREKYNRDTYK---------KVAMMESVEMSKDDFDQLCEAYNCKQKEDE------HQQPDI 479
              .||.....:..:         :||:...........:..|.:|..:::..|      ...||.
plant   286 --LMRSLTGEENVRGTSLSQEQARVAVRAVPASPVGVLEATCLSYRSEERTVESCTNSSQSSPDN 348

  Fly   480 NTKSN 484
            |..:|
plant   349 NNNNN 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 35/138 (25%)
Cyclin_C 334..450 CDD:281044 24/128 (19%)
CYCD2;1NP_001189576.1 Cyclin_N 65..196 CDD:278560 38/160 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10177
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.