DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and cntd2

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001038424.1 Gene:cntd2 ZFINID:ZDB-GENE-030131-5453 Length:398 Species:Danio rerio

Alignment Length:373 Identity:102/374 (27%)
Similarity:162/374 (43%) Gaps:83/374 (22%)


  Fly   103 EDNNDTQVAPSGKSLASLVDKENHDVKFGAGQKELVDYDLDSTPMSVTDVQSPMSVDRSILGVIQ 167
            ||......||.|:..:|.|.:|...:|:           |:..|       .|:|....:.|:::
Zfish    69 EDGIIMDYAPQGEPTSSDVYEEEALLKY-----------LNRLP-------GPLSFQELMPGLLR 115

  Fly   168 SSDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYFRESE------KKHRPKPLYMR 226
            ..     .|..:|..|             .|....|..||......|:      ....|||    
Zfish   116 RE-----VEVAISKLG-------------LLFDKTYAWDIFSDMMRSQLLCTLPNADLPKP---- 158

  Fly   227 RQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAK 291
                .:...|:||:|||::|.|.::...|||||:|..|:|.|..:.|..|.|||:|...:::|||
Zfish   159 ----FTDTTRAILVDWLIQVHEVFQFSEETLYLTVHLLNRALRLIKVSISGLQLLGVVCLFLAAK 219

  Fly   292 YEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDL--CTPTAYVFINTYAVLCDMPEKLK 354
            .||...|||.|..:|.:::|:|.|:||||:.:|..|.|||  |.|..::.|:.....|.  :|:.
Zfish   220 REECLLPEVSELCYLMENAYSKKQLLRMERRVLIGLKFDLYHCPPLHFLLISASIARCS--DKVV 282

  Fly   355 YMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLE-------------EITTY 406
            :|..|:.||||:||...: |||:.::.|::.|||.|| .|...|..|             |....
Zfish   283 WMARYLLELSLLEGRCVV-YLPAQLAGAALRLARKIL-QEAAAPEAEMAWCIASSIHIGSEAVLL 345

  Fly   407 KLEDLKTVVLHLCHTHKTAKELNTQAMREKYNRDTYKKVAMMESVEMS 454
            .:..:..:......|.:|              |.|:.|.:.::::.:|
Zfish   346 SIMQIMAIAAARAQTRET--------------RATFIKFSTVQTLHVS 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 51/134 (38%)
Cyclin_C 334..450 CDD:281044 30/129 (23%)
cntd2NP_001038424.1 Cyclin_N 136..259 CDD:278560 50/131 (38%)
Cyclin_C 264..384 CDD:281044 31/135 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.