DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and ccnb2

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_955462.1 Gene:ccnb2 ZFINID:ZDB-GENE-030429-12 Length:386 Species:Danio rerio

Alignment Length:425 Identity:112/426 (26%)
Similarity:195/426 (46%) Gaps:56/426 (13%)


  Fly    39 EKNALAPRANFAVLNGNNNVPRPAGKVQVFRDVRNLNVDENVEYGAKKSNVVPVVEQFKTFSVYE 103
            |.:||...:|...:.........|.:..||.::.||:     ....:...|||:           
Zfish     2 EMHALRNASNPIYVGAKGGPVSGAVRRPVFGELSNLS-----HKPVQTKKVVPM----------- 50

  Fly   104 DNNDTQVAPSGKSLASLVDKENHDVKFGAGQKELVDYDLDSTPMSVTDVQSPMSVDRSILGVIQS 168
                ..|.|:|:|  ::|..::..|:          ::......:|...|:.:|        ::.
Zfish    51 ----QSVKPTGRS--AVVHPKSAQVQ----------HEAPKPAATVPPAQADVS--------MKE 91

  Fly   169 SDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISH 233
            .::.......:.|...:.|    .|........:|..||..|.|..|.:...:|.||... ||:.
Zfish    92 EELCQAFSNSLFPVDDIDE----GDADMPQLCSEYVKDIYSYLRRLEGQQSVRPRYMEGY-DING 151

  Fly   234 NMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPP 298
            .||::|:|||::|...::|..||||::|..|||||....|.|.||||||..||.||.||||:|.|
Zfish   152 RMRALLVDWLIQVHSRFQLLQETLYMTVAILDRFLQVQPVTRRKLQLVGVTAMLIACKYEEMYVP 216

  Fly   299 EVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISEL 363
            .||:|.::.||::||||:..||.::|..|:|.|..|....|:...:...:...:...:..|..||
Zfish   217 MVGDFAYIADDAFTKAQIREMEMLMLSGLNFKLGRPLPLHFLRRASKAGNADAEKHTLAKYFLEL 281

  Fly   364 SLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHLCH-----THK 423
            :|::.: .:.|.||..::|::.|::.:|..:.|:...:..:||....||.::..:..     ...
Zfish   282 TLLDYD-MVHYNPSETAAAALCLSQLVLDGQKWSSTQQHYSTYDEAHLKPIMQLIAKNVVMVNEG 345

  Fly   424 TAKELNTQAMREKYNRDTYKKVAMMESVEMS--KD 456
            .:|.|   .:|:||......|::::..::.|  ||
Zfish   346 LSKHL---TVRKKYASSRLMKISLLPQLKSSLVKD 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 61/126 (48%)
Cyclin_C 334..450 CDD:281044 23/121 (19%)
ccnb2NP_955462.1 Cyclin_N 125..250 CDD:278560 61/126 (48%)
Cyclin_C 252..370 CDD:281044 23/122 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126649
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.