DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and cdc13

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001342891.1 Gene:cdc13 PomBaseID:SPBC582.03 Length:482 Species:Schizosaccharomyces pombe

Alignment Length:471 Identity:137/472 (29%)
Similarity:218/472 (46%) Gaps:55/472 (12%)


  Fly    40 KNALAPRANFAVLNG------NNNVPRPAGKVQVFRDVRNLNVDENVEYGAKKSNVVPVVEQFKT 98
            |::|....| :::||      :.|||:   |.....||.|.:..|.|...:|.:||     :..|
pombe    32 KSSLHSSEN-SLVNGKKATVSSTNVPK---KRHALDDVSNFHNKEGVPLASKNTNV-----RHTT 87

  Fly    99 FSVYEDNNDTQVAPSGKSLASLVDKENHDVKFGAGQKELVDYDLDSTPMSVT------------- 150
            .||     .|:.|...||:....|.|....|  ..|..:.:..:.|.|..::             
pombe    88 ASV-----STRRALEEKSIIPATDDEPASKK--RRQPSVFNSSVPSLPQHLSTKSHSVSTHGVDA 145

  Fly   151 ----DVQSPMSVDRSILGVIQSSDI-SVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEY 210
                ....|..:.:.:...:.|.|| .:..::..||..:..:.....|....|.|.:|.:||.||
pombe   146 FHKDQATIPKKLKKDVDERVVSKDIPKLHRDSVESPESQDWDDLDAEDWADPLMVSEYVVDIFEY 210

  Fly   211 FRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVR 275
            ..|.|.:..|.|.||.|||:::..||.||.|||:||...::|..|||:|:|..:|||||......
pombe   211 LNELEIETMPSPTYMDRQKELAWKMRGILTDWLIEVHSRFRLLPETLFLAVNIIDRFLSLRVCSL 275

  Fly   276 SKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFI 340
            :||||||.||::||:||||:..|.|..||::.|..|.:.::|:.|:.||::|.|:|..|....|:
pombe   276 NKLQLVGIAALFIASKYEEVMCPSVQNFVYMADGGYDEEEILQAERYILRVLEFNLAYPNPMNFL 340

  Fly   341 NTYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITT 405
            ...:.......:.:.:..|:.|:.|:: ...|.|.||...:|::.|||.:||...|...|...:.
pombe   341 RRISKADFYDIQTRTVAKYLVEIGLLD-HKLLPYPPSQQCAAAMYLAREMLGRGPWNRNLVHYSG 404

  Fly   406 YKLEDLKTVVLHLCHTHKTAKELNTQAMREKYNRDTYKKVAMM-------ESVEMSKDDFDQLCE 463
            |:...|.:||..:  .:...|.:..:|..:||....:.|.::.       .|:.:. ||.|   |
pombe   405 YEEYQLISVVKKM--INYLQKPVQHEAFFKKYASKKFMKASLFVRDWIKKNSIPLG-DDAD---E 463

  Fly   464 AYNC-KQKEDEHQQPD 478
            .|.. |||..:|...|
pombe   464 DYTFHKQKRIQHDMKD 479

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 60/126 (48%)
Cyclin_C 334..450 CDD:281044 26/123 (21%)
cdc13NP_001342891.1 COG5024 5..454 CDD:227357 126/441 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126649
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.