DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and cig1

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_588110.2 Gene:cig1 PomBaseID:SPCC4E9.02 Length:415 Species:Schizosaccharomyces pombe

Alignment Length:431 Identity:105/432 (24%)
Similarity:186/432 (43%) Gaps:91/432 (21%)


  Fly    68 FRDVRNLNVDENVEYGAKKSNV------------VPVVEQFKTFSVYEDNNDTQVAPSGKSLASL 120
            |:|...|..|.  .|..|||::            |..:.|....::.|.||::.::      :|.
pombe    13 FQDENQLQKDH--IYVKKKSHIKLNTGVRAPFKAVDNINQQDEPTLIEGNNESSIS------SST 69

  Fly   121 VDKENHDVKFGAGQKELVDYDLDSTPMSVTDVQSPMSVDRSILGVIQSSDISVGTETGVSPTG-- 183
            .|....|..: ..:.|:.:..:.|||.|:.|..            :::.:.|.....|:...|  
pombe    70 GDTFEEDFAY-QDKVEIEERSIRSTPKSIGDDD------------LENREGSFDAPEGILTHGKH 121

  Fly   184 RVKELP--PRNDRQRFLE--------------------VVQYQMDILEYFRESEKKHRPKPLYMR 226
            |:..:|  .:.|.....|                    |..|..:|..|.:..|:|..|.|.||.
pombe   122 RLPTIPEWTKEDLAALSEAAARLQANPSPEDIETDPSMVPDYDPEIFHYMQSLERKLAPPPNYMS 186

  Fly   227 RQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAK 291
            .|::|....|.:|:||:|:|...::|..|||:|:|..:|||||...|...|:||||.:|:.||.|
pombe   187 VQQEIDWVTRHMLVDWIVQVQIHFRLLPETLFLAVNLIDRFLSIKVVSLQKVQLVGLSALLIACK 251

  Fly   292 YEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYM 356
            ||||:||.:..|..:....:|..:::|.|:.:|.:|.||:..|....|:...:........::.:
pombe   252 YEEIHPPSIYNFAHVVQGIFTVDEIIRAERYMLMLLDFDISWPGPMSFLRRISRADSYDHDIRML 316

  Fly   357 TLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHLCHT 421
            ..|:.|::||: |.::....|.:::.:..|:..:||...|||                 .|:.::
pombe   317 AKYLQEVTLMD-EIFIGAHISFIAATAYYLSMQMLGHLDWTP-----------------CHVYYS 363

  Fly   422 HKTAKEL----------------NTQAMREKYNRDTYKKVA 446
            ..||::|                :..|:..||:.:..|:|:
pombe   364 GYTARQLKPCAIIIMECLVDAPNHHNAIYRKYSENRMKRVS 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 51/126 (40%)
Cyclin_C 334..450 CDD:281044 23/130 (18%)
cig1NP_588110.2 COG5024 1..414 CDD:227357 105/432 (24%)
Cyclin_N 166..292 CDD:278560 51/126 (40%)
Cyclin_C 294..408 CDD:281044 23/130 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126649
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.