DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and Ccnb3

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_898836.2 Gene:Ccnb3 MGIID:2183443 Length:1396 Species:Mus musculus

Alignment Length:429 Identity:123/430 (29%)
Similarity:202/430 (47%) Gaps:94/430 (22%)


  Fly    68 FRDVRNLNVDENVEYGAKKSNVVPVVEQFKTFSVYED---------------NNDTQVAPSGKSL 117
            |.|::|.          :::.:|...|.||:|.|:|:               :|.:.:.||.|:.
Mouse  1029 FTDLQNF----------EETKIVDEEEFFKSFLVFENKNSPNMSSNAFESRTDNSSAIMPSSKAF 1083

  Fly   118 ASLVDKENHDVK--------FGAGQKEL-VDYDLDSTPMSVTDVQSPMSVDRSILGVIQSSDISV 173
             :.|:..|..|.        .||.:.|: :..|.||......:.|.|      :|..|       
Mouse  1084 -NPVENSNPYVSSSKSFKSTLGAKETEITIQDDSDSLERIEKEGQDP------LLNTI------- 1134

  Fly   174 GTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSI 238
                                         |..|:..|.:|.|:|...:. ||..|.:::.:||:|
Mouse  1135 -----------------------------YAKDVFNYLKEREEKFLVQK-YMDGQMELTSDMRAI 1169

  Fly   239 LIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEF 303
            |:|||||:...:::..|||||:|..:|.:|.:....::.|||:|:....||||:||.|||.:.||
Mouse  1170 LVDWLVEIQGSFQMTHETLYLAVKIMDLYLMKAQCKKNHLQLLGSTTYMIAAKFEESYPPSLSEF 1234

  Fly   304 VFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEG 368
            :|:.:|.|.|:.::.:|..||:.|:||:..||||.|:..||.......|...::.:|.|::|.|.
Mouse  1235 LFICEDMYEKSDMVSLESSILQTLNFDINIPTAYNFLRRYASCIHASMKTLTLSRFICEMTLQEY 1299

  Fly   369 ETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHLCH-----THKTAKEL 428
            | |::..||.:::||..||.::..:....|.||..|.||:.:|..:|..|.|     :|...|. 
Mouse  1300 E-YIEERPSKLAAASFILALYMRNLSNCVPTLEYFTGYKMAELHILVRKLNHLLNFRSHSILKN- 1362

  Fly   429 NTQAMREKYNRDTYKKVAMMESVEMSKDDFDQLCEAYNC 467
                :.|||:.:||.:||.:.  .:||.|.:.|   .||
Mouse  1363 ----VFEKYSEETYFEVAKIP--PLSKQDLENL---LNC 1392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 50/126 (40%)
Cyclin_C 334..450 CDD:281044 39/121 (32%)
Ccnb3NP_898836.2 D-box 54..62
Cyclin_N 1138..1263 CDD:278560 50/126 (40%)
Cyclin_C 1265..1381 CDD:281044 39/124 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D520533at33208
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.