DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and ccna2

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_694481.1 Gene:ccna2 ZFINID:ZDB-GENE-020418-1 Length:428 Species:Danio rerio

Alignment Length:479 Identity:171/480 (36%)
Similarity:251/480 (52%) Gaps:95/480 (20%)


  Fly     6 IH-QDMSNKENPGIKIPAGVKNTKQPLAVIGGKAEKNALAPRANFAVLNGNNNVPRPAGKVQVFR 69
            :| .|:.|:||              .|:.:.|.|.||.:..|.|   :|.|   |:.|....|..
Zfish     8 VHDSDIHNQEN--------------MLSRLRGAAAKNRVENREN---VNPN---PKAANNRTVLG 52

  Fly    70 DVRN---------------------LNVDENV-EYGAKKSNVVPVVEQFKTFSVYEDNND---TQ 109
            ::.|                     ...:||. .:|.:.||..|.     .|.::.|..|   ::
Zfish    53 ELENSQRRQLGLRGAKQGSGPQIIACKPEENARSFGERPSNRQPA-----AFQIHVDEPDGACSK 112

  Fly   110 VAPSGKSLASLVDKENHDVKFGAGQKELVDYDLDSTPM----SVTDVQSPM-SVDRSILGVIQS- 168
            .||..:|                        .:|.:|:    :||.::.|: ::|..:.....| 
Zfish   113 KAPLQRS------------------------TMDCSPLTLNPTVTRLRQPLATIDLPLEASFDSP 153

  Fly   169 SDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISH 233
            .|:|| .:....||             ...||..|..:|..:.||.|.|.:||..|||:|.||::
Zfish   154 MDMSV-IDCEERPT-------------NVNEVSDYAAEIHTHLREMEVKSKPKAGYMRKQPDITN 204

  Fly   234 NMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPP 298
            :||:||:||||||.|||||..|||||:|.|:|||||.|:|:|.||||||||||.:|:|:||||||
Zfish   205 SMRAILVDWLVEVGEEYKLQNETLYLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPP 269

  Fly   299 EVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISEL 363
            ||.|||::|||:|||.||||||.::|.:|||||..||...|:..|.:...:..|::.:::::.||
Zfish   270 EVAEFVYITDDTYTKKQVLRMEHLVLTVLSFDLAAPTINQFLTQYFLHQPVSSKVESLSMFLGEL 334

  Fly   364 SLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHLCHTHKTAKEL 428
            ||::.:.:|:||||.|::|:..||.|.|....|:..|.::|.|.||||...|..|..|:..|.:.
Zfish   335 SLIDCDPFLKYLPSQMAAAAFILANHTLASGSWSKSLVDLTGYSLEDLLPCVQDLHQTYLAASQH 399

  Fly   429 NTQAMREKYNRDTYKKVAMMESVE 452
            ..||:||||....|.:|:::|..|
Zfish   400 AQQAVREKYKGSKYHEVSLIEPPE 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 84/126 (67%)
Cyclin_C 334..450 CDD:281044 41/116 (35%)
ccna2NP_694481.1 Cyclin_N2 33..157 CDD:293109 28/159 (18%)
Cyclin_N 177..303 CDD:278560 84/126 (67%)
Cyclin_C 305..422 CDD:281044 41/117 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5024
Hieranoid 1 1.000
Homologene 1 1.000 H55562
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D520533at33208
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 1 1.000 T596343
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10177
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.