DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and W05G11.2

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_497132.2 Gene:W05G11.2 WormBaseID:WBGene00021040 Length:192 Species:Caenorhabditis elegans

Alignment Length:160 Identity:39/161 (24%)
Similarity:65/161 (40%) Gaps:31/161 (19%)


  Fly   224 YMR-RQKDISHNMRSILIDWLV-EVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAM 286
            |.| ||...:.|.|     |.: :...||....|..:|:|..:|..|....:.:.:.||||..:|
 Worm     7 YRRWRQHCFAKNER-----WKISDAVREYNFQKEAFHLAVSLVDLALPMFIIDKMRFQLVGITSM 66

  Fly   287 YIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPE 351
            .|......:....|.:|             |.|||:|.| ..|.:..||.......:|...::.:
 Worm    67 MITKIRGNLPTNRVPDF-------------LLMEQLIGK-FEFVVAKPTPSWLGACFAKRINLTK 117

  Fly   352 KLKYMTLYISELSLME----GETYLQYLPS 377
            |::      :::.|:|    ...:|:|.||
 Worm   118 KMR------NDVKLLELSPIDAYFLRYSPS 141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 29/110 (26%)
Cyclin_C 334..450 CDD:281044 10/49 (20%)
W05G11.2NP_497132.2 CYCLIN <28..>68 CDD:294043 12/40 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.