DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and T07F10.5

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_506221.3 Gene:T07F10.5 WormBaseID:WBGene00011591 Length:116 Species:Caenorhabditis elegans

Alignment Length:70 Identity:17/71 (24%)
Similarity:35/71 (49%) Gaps:8/71 (11%)


  Fly   308 DDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEGETYL 372
            ||.::      ||:.::....|.:..||.....:.:|...::.:|:: ..:.:.|||.::.. ||
 Worm    23 DDDHS------MERFLIGKFEFVVAKPTPSWLGSYFAKRINLTKKMR-NDVKLLELSPIDAH-YL 79

  Fly   373 QYLPS 377
            :|.||
 Worm    80 RYRPS 84

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 5/24 (21%)
Cyclin_C 334..450 CDD:281044 12/45 (27%)
T07F10.5NP_506221.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.