DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and cyb-3

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_506825.4 Gene:cyb-3 WormBaseID:WBGene00000868 Length:385 Species:Caenorhabditis elegans

Alignment Length:309 Identity:87/310 (28%)
Similarity:160/310 (52%) Gaps:42/310 (14%)


  Fly   178 GVSPTGR--VKELPPRNDRQRFLE-----------------VVQYQMDILEYFRESEKKHRPKPL 223
            |.|.|.|  |:.|||:  :.|:::                 :..|...|.:|:|..|...|.:. 
 Worm    70 GKSRTSRRDVENLPPQ--KSRYVDPCPHYDYDLEEAGNPDSISDYAQGIFDYYRHREVHFRVRK- 131

  Fly   224 YMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMA-VVRSKLQLVGTAAMY 287
            |:.:..::....|:|||||:||:.|.::|:.||||.:|...|.:|.:.. |.::.:|.:...|::
 Worm   132 YLHKHPEVDVKTRAILIDWMVEIQETFELNHETLYNAVKLTDMYLCKTKNVDKNTIQKLACVAIF 196

  Fly   288 IAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEK 352
            |||||:|..||.|.:.::|:.|.:::.::|.||:.:...:.:||.:|.:|.::..:..:|.:..|
 Worm   197 IAAKYDERSPPLVDDLIYLSGDRFSRDELLAMERELFATVGYDLGSPLSYRYLRRFGRVCRVDMK 261

  Fly   353 LKYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEM--------WTPRLEEITTYKLE 409
            ...|..:|.|.|||      .|..:::|.:.:|.|..:|.|.|        |.|.||:.:.:..|
 Worm   262 TLTMGRFILETSLM------VYEYAMVSQSRLAAAAFVLAMRMLDKNNEYEWNPVLEKYSGFTGE 320

  Fly   410 DLKTVVLHLCHTHKTAKELNTQ--AMREKYNRDTYKKVAMMESVEMSKD 456
            ::..:|.|:.|....:|:...|  ::|:||:.:.:..||   |:.|..|
 Worm   321 EVMPLVEHMNHILHFSKDKWAQLTSVRQKYSHEVFFHVA---SIPMLPD 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 42/127 (33%)
Cyclin_C 334..450 CDD:281044 32/126 (25%)
cyb-3NP_506825.4 Cyclin_N 116..241 CDD:278560 42/126 (33%)
Cyclin_C 243..364 CDD:281044 34/130 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.