DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and cya-1

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_499018.1 Gene:cya-1 WormBaseID:WBGene00000863 Length:485 Species:Caenorhabditis elegans

Alignment Length:478 Identity:127/479 (27%)
Similarity:210/479 (44%) Gaps:65/479 (14%)


  Fly    10 MSNKENPGIKIPAGVKNTKQPL--AVIGGKAEKNALAPRANFAVLNGNNNVPR---PAGKV---- 65
            :|.|.:.|....:...|.|..:  |.:|||..:..           |.:|:.:   |:.|:    
 Worm     5 LSLKPSNGNAAKSQAVNNKNVIKNAPLGGKLTRQI-----------GTSNLLQQALPSKKIDESP 58

  Fly    66 ----------QVFRD--VRNLNVDENVEYGAKKSNVVPVVEQFKTFSVYEDNN---DTQVAPSGK 115
                      :||.|  ....|..|||:...|.|||:|.          ||||   :.:.....|
 Worm    59 IIKIDAKDSFKVFEDQEPEKENSSENVDATEKDSNVIPA----------EDNNMIHELERKMEEK 113

  Fly   116 SLAS------LVDKENHDV--KFGAGQKE---LVDYDLDSTPMSVTDVQSPMSVDRSILGVIQSS 169
            |.|.      :..::|.|:  :|.....|   |.|.| |...:||.......|| |:........
 Worm   114 SRAEKLKFKFMQTRDNSDITSRFSEPPSEFSVLCDDD-DCDKVSVASSTFTTSV-RATFSSFHFD 176

  Fly   170 D----ISVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKD 230
            :    ...|.|..|....:......|:|.....|  ::..||::|....:.|:|........|..
 Worm   177 ENQRKKEFGKEEAVKKIQKKAAKEARDDSMFSSE--EFFPDIIKYMLHRQTKNRASHECFDIQSQ 239

  Fly   231 ISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEI 295
            ::..||:|||||..:|.:||....||.:|:|..:||.||...:.:.:.|||||.:|.||.|||||
 Worm   240 VNEEMRTILIDWFSDVVKEYNFQKETFHLAVSLVDRALSMFNIDKMRFQLVGTTSMMIAVKYEEI 304

  Fly   296 YPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYI 360
            :|||:.:|..:||::|....:|.||:.:|....|.:..||:..|...:|...:..:|::....|:
 Worm   305 FPPEIEDFALITDNTYRVPDILLMERFLLGKFDFVVAMPTSSWFGTCFAKRMNFTKKMRNTVHYL 369

  Fly   361 SELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHLCHTHKTA 425
            .||||::.. :|:|.||.:::|:...|.....:|.|..::.:.|....||...|:..|...:..|
 Worm   370 LELSLIDVH-FLRYRPSDIAAAACCFANLQADVESWPQKMVDDTGISTEDFVDVLRDLHRMYLNA 433

  Fly   426 KELNTQAMREKYNRDTYKKVAMM 448
            ...:.:::...|:.....:||::
 Worm   434 STADFKSIFYNYSETAQMEVALL 456

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 49/126 (39%)
Cyclin_C 334..450 CDD:281044 27/116 (23%)
cya-1NP_499018.1 Cyclin_N 215..338 CDD:278560 48/123 (39%)
Cyclin_C 343..459 CDD:281044 27/116 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I3062
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 1 1.000 T476028
orthoMCL 1 0.900 OOG5_126649
Panther 1 1.100 LDO PTHR10177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.920

Return to query results.
Submit another query.