DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and Ccnf

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_006523617.1 Gene:Ccnf MGIID:102551 Length:790 Species:Mus musculus

Alignment Length:436 Identity:97/437 (22%)
Similarity:191/437 (44%) Gaps:85/437 (19%)


  Fly    72 RNLNVDENVEYGAKKSNVVPVVEQ-------FKTFSVYEDNNDTQVAPSGKSLASLVDKENHDVK 129
            |.||:.|:.|   |:.....::|:       ..::.::|.:....::..|:.|.|.         
Mouse   205 RVLNLFEDEE---KRKQARSLLEESSRQGCLISSYLLWESDRKVDMSDPGRCLHSF--------- 257

  Fly   130 FGAGQKELVDYDLDSTPMSVTDVQSPMSVDRSILGVIQSSDISVGTETGVSPTGRVKELPPRNDR 194
                 ::|.||.....      .::.:::.::..|         |::.|                
Mouse   258 -----RKLRDYAAKGC------WEAQLALAKACAG---------GSQLG---------------- 286

  Fly   195 QRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYL 259
               ||.......:.:.|:.|:..::.:...:  ||.:|..||.|||||||||:......:..|:|
Mouse   287 ---LEGKACSESVCQLFQASQAVNKQQIFSV--QKGLSDTMRYILIDWLVEVATMKDFTSLCLHL 346

  Fly   260 SVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKY--EEIYPPEVGEFVFLTDDSYTKAQVLRMEQV 322
            :|..:||:|.:..|.|.||||:|.|.|.|..::  :||.  .:.|.|:|||::|....::|:...
Mouse   347 TVECVDRYLRRRLVPRYKLQLLGIACMVICTRFISKEIL--TIREAVWLTDNTYKYEDLVRVMGE 409

  Fly   323 ILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSSASVALA 387
            |:..|...:..||...:......|..:..:.:::..::.||:|:.....: |.|:.::||::.||
Mouse   410 IISALEGKIRIPTVVDYKEVLLTLVPVAPRTQHLCSFLCELTLLHTSLSI-YAPARLASAALLLA 473

  Fly   388 RHILGM-EMWTPRLEEITTYKLEDLKTVVLHLCHTHKTA---------KELNTQAMREKYNRDTY 442
            |.:.|. :.||..|.::|.:...||...||.|   ||..         ::::..|:::::....|
Mouse   474 RLMHGQTQPWTTHLWDLTGFSYSDLVPCVLSL---HKKCFHDDAPKDYRQVSLTAVKQRFEDKCY 535

  Fly   443 KKVAMMESVEMSKDDFDQLCEAYNCKQKEDEHQQPDINTKSNVNLF 488
            ::::..|.:     .:..||.....||:..|  .|...:...::.|
Mouse   536 EEISREEVL-----SYADLCSTIGVKQESPE--PPSFPSSGEIHTF 574

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 43/128 (34%)
Cyclin_C 334..450 CDD:281044 28/126 (22%)
CcnfXP_006523617.1 FBOX 48..86 CDD:197608
Cyclin_N 294..419 CDD:278560 43/129 (33%)
Cyclin_C 438..544 CDD:281044 25/110 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.