DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CycA and Ccna1

Sequence 1:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001292150.1 Gene:Ccna1 MGIID:108042 Length:421 Species:Mus musculus

Alignment Length:421 Identity:162/422 (38%)
Similarity:224/422 (53%) Gaps:61/422 (14%)


  Fly    46 RANFAVLNGNNNVPRPAGKVQVFRDVRNLNVDENVEYGAKKSNVVPVVEQFKTFSVYEDNNDTQV 110
            |....||..|....|..|  |....:|..:..|||...|.|             .|..|:...:.
Mouse    37 RTVLGVLTENEQYRRTCG--QEITAIRCFSGSENVFPAAGK-------------KVLSDHGVNEP 86

  Fly   111 APSGKSLASLVDKENHDVKFGAGQKELV---DYDLDSTPMSVTDVQ--------SPMSVDRSILG 164
            |..|..: .:.|.|..|....:|::.::   .|::| |.|..:|:.        |||.||     
Mouse    87 AKRGFDI-YMDDPEQGDRDTCSGKEGIIFEDVYEVD-TSMLKSDLHFLLDFNTVSPMLVD----- 144

  Fly   165 VIQSSDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQK 229
                            ||...:.....:.....:.|.:|..:|..|.||:|.:||||..|||:|.
Mouse   145 ----------------PTTHAQSEEATDFGSDVINVTEYAEEIHRYLREAEVRHRPKAHYMRKQP 193

  Fly   230 DISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEE 294
            ||:..||:||:||||||.|||||.||||||:|.:||||||.|:|:|.|||||||||:.:|:||||
Mouse   194 DITEGMRAILVDWLVEVGEEYKLRTETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAILLASKYEE 258

  Fly   295 IYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTY---AVLCDMPEKLKYM 356
            ||||:|.|||::|||:|||.|:||||.::||:|:|||..||...|:..|   ..:|...|.|   
Mouse   259 IYPPDVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCIRTENL--- 320

  Fly   357 TLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHLCHT 421
            ..|::||||:|.:.:|:|||||:::|:..||.:|:....|...|...|.|.|.:   :|..|...
Mouse   321 AKYVAELSLLEADPFLKYLPSLVAAAAYCLANYIVNRHFWPETLAAFTGYSLNE---IVPCLSEL 382

  Fly   422 HKTAKEL---NTQAMREKYNRDTYKKVAMME 449
            ||....:   ..||:||||....|..|::||
Mouse   383 HKACLSIPHRPQQAIREKYKASKYLHVSLME 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 85/126 (67%)
Cyclin_C 334..450 CDD:281044 42/123 (34%)
Ccna1NP_001292150.1 Cyclin_N 170..296 CDD:278560 85/126 (67%)
Cyclin_C 298..415 CDD:281044 42/123 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5024
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 254 1.000 Inparanoid score I3159
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D520533at33208
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 1 1.000 T615613
orthoMCL 1 0.900 OOG5_126649
Panther 1 1.100 O PTHR10177
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.830

Return to query results.
Submit another query.