DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42255 and Tnfaip6

Sequence 1:NP_729748.3 Gene:CG42255 FlyBaseID:FBgn0259140 Length:3613 Species:Drosophila melanogaster
Sequence 2:NP_445834.1 Gene:Tnfaip6 RGDID:621359 Length:275 Species:Rattus norvegicus

Alignment Length:145 Identity:52/146 (36%)
Similarity:75/146 (51%) Gaps:10/146 (7%)


  Fly  1066 CGGTFTARFGYIKSPNWPKNYGESQMCEWILRAPFGHRIELVVHNFTLEEEYSSTGCWTDWLEIR 1130
            |||.||......|||.:|..|.::|:|.|.:|..:|.||.|...:|.||.:   .||..|::||.
  Rat   135 CGGVFTDPKRIFKSPGFPNEYDDNQVCYWHIRLKYGQRIHLSFLDFDLEHD---PGCLADYVEIY 196

  Fly  1131 NGDSESSPLIGRYCGNEIPSRIPSFGNVLHLKFKSDDSMEEKGFLLSWQQMGAGCGGKLSSSMGT 1195
            :...:....:|||||:|:|..|.|.|||:.|||.||.|:...||.:.:..:..  ..|.:....|
  Rat   197 DSYDDVHGFVGRYCGDELPEDIISTGNVMTLKFLSDASVTAGGFQIKYVTVDP--APKSNQGKNT 259

  Fly  1196 IHSPHLLAGNRGILA 1210
                 .:.||:..||
  Rat   260 -----TMTGNKKFLA 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42255NP_729748.3 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 290..328 CDD:214542
EGF_CA 330..374 CDD:214542
EGF 427..455 CDD:278437
EGF_CA 462..496 CDD:238011
CUB 503..619 CDD:238001
CUB 624..738 CDD:238001
CUB 745..854 CDD:238001
CUB 857..963 CDD:238001
CUB 1066..1179 CDD:238001 46/113 (41%)
CUB 1185..1293 CDD:238001 6/27 (22%)
CUB 1303..1406 CDD:238001
CUB 1411..1523 CDD:238001
CUB 1530..1648 CDD:238001
CUB 1754..1862 CDD:238001
CUB 1979..2091 CDD:238001
CUB 2096..2193 CDD:294042
CUB 2210..2321 CDD:238001
CUB 2327..2441 CDD:238001
CUB 2688..2782 CDD:294042
CUB 2810..2911 CDD:238001
CUB 3029..3143 CDD:238001
CUB 3169..3249 CDD:294042
CUB 3499..3607 CDD:238001
Tnfaip6NP_445834.1 Link_domain_TSG_6_like 36..128 CDD:239592
CUB 135..244 CDD:278839 46/112 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.