DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42255 and nas-30

Sequence 1:NP_729748.3 Gene:CG42255 FlyBaseID:FBgn0259140 Length:3613 Species:Drosophila melanogaster
Sequence 2:NP_490795.4 Gene:nas-30 WormBaseID:WBGene00003548 Length:525 Species:Caenorhabditis elegans

Alignment Length:453 Identity:99/454 (22%)
Similarity:143/454 (31%) Gaps:174/454 (38%)


  Fly   973 NEPGRRYVTAVRGTFCQWFIDFPGRKKISIHTLGPTPSISIYDNSTSPGKLVNSYSGSVG----- 1032
            |.||:.||...||:.|.          .|:...|.:..|||.......|.:.:....|:|     
 Worm   154 NGPGKDYVIFFRGSGCY----------SSVGRTGGSQLISIGYGCEDKGIVAHEVGHSLGFWHEQ 208

  Fly  1033 ---DVFDGDLLTINLHTNWPRLEIYSIQFDIVQQDSCGGTFTAR-FGYIKSPNWPKNYGESQMCE 1093
               |..|    .|:|..:|           |::  ...|.|..| :..|:....|.:.|.     
 Worm   209 SRPDRDD----YIHLRKDW-----------IIK--GTDGNFEKRSWEEIEDMGVPYDVGS----- 251

  Fly  1094 WILRAPFGHRIELVVHNFTLEEEYSSTGCWTDW--LEIRNGDSESSPLIGR-------------- 1142
                         |:|       |.|.....||  :.|...||.....||:              
 Worm   252 -------------VMH-------YGSNAFTKDWDQITIETKDSRYQGTIGQRQKLSFIDVKQVNR 296

  Fly  1143 -YCGNEIPSRIPSFGNVLHLKF---------KSDDSMEEKGFLLSWQQMGAGCGGKL--SSSMGT 1195
             ||.:..|..:|    .:|..:         |..|                |.||||  .::.||
 Worm   297 LYCNSVCPVALP----CMHGGYPDPNNCAVCKCPD----------------GLGGKLCGRAAKGT 341

  Fly  1196 IHSP---HLLAG-------NRGILACDWQIIVAEGSRVSL---QLRSNDNRICSGQLTLYDGPTT 1247
            .|..   .|.|.       .:|...|:|::....|.||.|   :||..    |:.....|     
 Worm   342 DHDKCGGELTATAEWQEMVYKGKRTCNWKVKSPSGGRVRLVLTELRYQ----CAPACKAY----- 397

  Fly  1248 ASNPIVIRCNGTIAKPLQSTGNRVLV---RYDVGHDAPDG--------TDFMLNYQTNCRVRLEG 1301
                |.|:.|    ...|.||.||..   .|||..|..:.        .|:.::|      :|:.
 Worm   398 ----IEIKHN----TDFQQTGFRVCCFNKTYDVISDQSEALILSNANIVDYEVSY------KLQW 448

  Fly  1302 LQG---AIETPNFPENYPPGQD------CEWDIRAGG--RKNHLQLI----FSHLSVEKFSSI 1349
            :|.   |:..|.....:.||::      .|   .:||  .|..||.|    .||..:|..:||
 Worm   449 IQDNGKALPPPKPTSTWVPGKENRPFRGVE---NSGGTIEKFILQAIPKIRDSHRPLESITSI 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42255NP_729748.3 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 290..328 CDD:214542
EGF_CA 330..374 CDD:214542
EGF 427..455 CDD:278437
EGF_CA 462..496 CDD:238011
CUB 503..619 CDD:238001
CUB 624..738 CDD:238001
CUB 745..854 CDD:238001
CUB 857..963 CDD:238001
CUB 1066..1179 CDD:238001 24/140 (17%)
CUB 1185..1293 CDD:238001 34/134 (25%)
CUB 1303..1406 CDD:238001 17/63 (27%)
CUB 1411..1523 CDD:238001
CUB 1530..1648 CDD:238001
CUB 1754..1862 CDD:238001
CUB 1979..2091 CDD:238001
CUB 2096..2193 CDD:294042
CUB 2210..2321 CDD:238001
CUB 2327..2441 CDD:238001
CUB 2688..2782 CDD:294042
CUB 2810..2911 CDD:238001
CUB 3029..3143 CDD:238001
CUB 3169..3249 CDD:294042
CUB 3499..3607 CDD:238001
nas-30NP_490795.4 ZnMc_astacin_like 120..298 CDD:239807 39/196 (20%)
CUB 346..431 CDD:294042 25/102 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.