DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10361 and alas2

Sequence 1:NP_648509.1 Gene:CG10361 FlyBaseID:FBgn0036208 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001006926.1 Gene:alas2 XenbaseID:XB-GENE-487573 Length:608 Species:Xenopus tropicalis

Alignment Length:366 Identity:135/367 (37%)
Similarity:212/367 (58%) Gaps:13/367 (4%)


  Fly    59 VQGSDKKILNFCANNYLGLANNPEIVEHSQKLLEQYGAGLSSVRFICGTQDIHKQLEKKIAQFHG 123
            :.|..|::..:|:|:|||::.:|::::...:.||::|||....|.|.||...|..||.::|..|.
 Frog   205 LHGEKKEVSVWCSNDYLGMSRHPKVLKAIAEALEEHGAGAGGTRNISGTSKYHVDLECELADLHN 269

  Fly   124 REDTILYASCFDAN-AGIFE-AILTPEDAVFSDELNHASIIDGIRLCKAKKQRYRHRDLGDLEEQ 186
            ::..:|::|||.|| :.:|. |.:.|...::||..||||:|.|||.....|..:||.|...|||.
 Frog   270 KDAALLFSSCFVANDSTLFTLAKMLPGCEIYSDAGNHASMIQGIRNSGVTKFVFRHNDPAHLEEL 334

  Fly   187 L-KASDARLKLIATDGVFSMDGNIAPLARIVELARKYNALVFVDECHATGFFGATGRGTEEYDNV 250
            | ||:....|::|.:.|.||||.|.||..:.::|.||.||.||||.||.|.:|..|.|..|.|:|
 Frog   335 LQKANPKTPKIVAFETVHSMDGAICPLEEVCDIAHKYGALTFVDEVHAVGLYGTHGAGVGERDSV 399

  Fly   251 MGEVDIINSTLGKALGGASGGYTTGPAELISFLRQKSRPYLFSNTLPPAVVAVGLKVMDMLLQSS 315
            |.::|||:.|||||. |..|||....|.||..:|..:..::|:.:|||.|:|..::.: .:|:|.
 Frog   400 MHKMDIISGTLGKAF-GCVGGYVASTASLIDTVRSYAAGFIFTTSLPPMVLAGAVESV-RVLKSE 462

  Fly   316 E---LTQRVQSNTQRFRQAMTKAGFTIAGENHPICPVMLGDARLASQFADEMLTR-GIYVIGFSY 376
            |   |.:..|.|.:..||.:..||..:......|.|:.:|:|.:.::..|.:|:: .|||...:|
 Frog   463 EGQALRRAHQRNVKHMRQLLMDAGLPVINCPSHIIPIRVGNAAINTRICDVLLSQYNIYVQAINY 527

  Fly   377 PVVPQGKARIRVQISAAHT----EAEIDRAINAFIEVGRSL 413
            |.||:|:..:|:..|..||    ...::..::|:.|||..|
 Frog   528 PTVPRGEELLRLAPSPHHTPDMMNYFVESLVSAWKEVGMPL 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10361NP_648509.1 PRK06939 19..416 CDD:235893 135/367 (37%)
BioF 30..410 CDD:223234 133/362 (37%)
alas2NP_001006926.1 Preseq_ALAS 2..114 CDD:312538
AAT_I 164..568 CDD:327488 134/365 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0156
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D930001at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R554
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.