DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10361 and gcat

Sequence 1:NP_648509.1 Gene:CG10361 FlyBaseID:FBgn0036208 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001166025.1 Gene:gcat ZFINID:ZDB-GENE-060518-3 Length:431 Species:Danio rerio

Alignment Length:402 Identity:262/403 (65%)
Similarity:320/403 (79%) Gaps:1/403 (0%)


  Fly    16 RHYSAAAQAQLREILGTQLAGIKDAGTFKAERIITSSQSTQITVQGSDKKILNFCANNYLGLANN 80
            |.::.||...::.:|..:|..|:.|||:|.||:|||.|...|.|.||...||||||||||||:::
Zfish    29 RAFAPAAPQAVQSVLEAELDSIRAAGTWKGERVITSKQGPHICVDGSRGDILNFCANNYLGLSSH 93

  Fly    81 PEIVEHSQKLLEQYGAGLSSVRFICGTQDIHKQLEKKIAQFHGREDTILYASCFDANAGIFEAIL 145
            ||:|:...:.|::|||||||||||||||||||.||:|:||||.|||.||||||||||||:||.:|
Zfish    94 PEVVKAGVEALQKYGAGLSSVRFICGTQDIHKNLEEKLAQFHEREDCILYASCFDANAGLFEVLL 158

  Fly   146 TPEDAVFSDELNHASIIDGIRLCKAKKQRYRHRDLGDLEEQLKAS-DARLKLIATDGVFSMDGNI 209
            .|:|||.||||||||||||||||:||:.||:|.||.||||:||.| .:||:|:.|||||||||::
Zfish   159 GPDDAVLSDELNHASIIDGIRLCRAKRFRYKHMDLNDLEEKLKESQSSRLRLVVTDGVFSMDGDV 223

  Fly   210 APLARIVELARKYNALVFVDECHATGFFGATGRGTEEYDNVMGEVDIINSTLGKALGGASGGYTT 274
            |||..|.:||.:|.|:||:||||||||.||.||||:|...||..|.|:|||||||||||:||||.
Zfish   224 APLKGICDLAEQYGAMVFIDECHATGFMGARGRGTDELLGVMDRVQIVNSTLGKALGGAAGGYTV 288

  Fly   275 GPAELISFLRQKSRPYLFSNTLPPAVVAVGLKVMDMLLQSSELTQRVQSNTQRFRQAMTKAGFTI 339
            ||..||..|||:||||||||:|||.||....:.:::||.|:|:.|.:.:.|.|||..||:|||||
Zfish   289 GPKALIELLRQRSRPYLFSNSLPPPVVGCATRAVELLLASNEIAQSMAAKTMRFRNNMTQAGFTI 353

  Fly   340 AGENHPICPVMLGDARLASQFADEMLTRGIYVIGFSYPVVPQGKARIRVQISAAHTEAEIDRAIN 404
            :|..|||||||||||||||..||:||..|:|||||||||||:||||||||||||||:.:|||.::
Zfish   354 SGSAHPICPVMLGDARLASLMADDMLKLGVYVIGFSYPVVPKGKARIRVQISAAHTDEDIDRTVD 418

  Fly   405 AFIEVGRSLKVI 416
            |||:.||...||
Zfish   419 AFIQTGRKHGVI 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10361NP_648509.1 PRK06939 19..416 CDD:235893 260/398 (65%)
BioF 30..410 CDD:223234 255/381 (67%)
gcatNP_001166025.1 PRK06939 37..430 CDD:235893 258/393 (66%)
BioF 40..420 CDD:223234 253/380 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C149787314
eggNOG 1 0.900 E1_COG0156
Hieranoid 1 1.000
Homologene 1 1.000 H8475
Inparanoid 1 1.050 530 1.000 Inparanoid score I1157
OMA 1 1.010
OrthoDB 1 1.010 D312139at33208
OrthoFinder 1 1.000 FOG0006341
OrthoInspector 1 1.000 T1054119
orthoMCL 1 0.900 OOG5_126783
Panther 1 1.100 LDO PTHR13693
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R554
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.