DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10361 and lace

Sequence 1:NP_648509.1 Gene:CG10361 FlyBaseID:FBgn0036208 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001285957.1 Gene:lace FlyBaseID:FBgn0002524 Length:597 Species:Drosophila melanogaster

Alignment Length:419 Identity:123/420 (29%)
Similarity:201/420 (48%) Gaps:28/420 (7%)


  Fly    18 YSAAAQAQLREILGTQLAGIK-DAGTFKAERIITSSQSTQITVQGSDKKILNFCANNYLGL-ANN 80
            ||.....::::.....:..:. |..|.|..  :|..........|::.:.||..:.||||. |..
  Fly   168 YSRYVYRRIKDCWNRPICSVPGDELTLKDR--VTDDYGWSFKFTGTETRCLNLGSYNYLGFAAAT 230

  Fly    81 PEIVEHSQKLLEQYGAGLSSVRFICGTQDIHKQLEKKIAQFHGREDTILYASCFDANAGIFEAIL 145
            .:..:.|::.....|....|.|...|..:..::||...|::.|.||.|::...|..||....::|
  Fly   231 GQCADDSEESARSSGLAYCSSRCELGDNEQLQELEALTARYFGVEDAIVFGMGFATNALNLPSLL 295

  Fly   146 TPEDAVFSDELNHASIIDGIRLCKAKKQRYRHRDLGDLEEQLKAS-------------DARLKLI 197
            .|...|.|||.||||||.|:||..|..:.::|.::.|||..|:..             |.  .:|
  Fly   296 GPNSLVISDEKNHASIILGLRLSGATTKVFKHNNMRDLERVLRQGVCYGNPKKGGQPWDK--VMI 358

  Fly   198 ATDGVFSMDGNIAPLARIVELARKYNALVFVDECHATGFFGATGRGTEEYDNV-MGEVDIINSTL 261
            ..:|:|||:|:|..|..::.|.:||.|.:::||.|:.|..|:.|||..:|.|| ..||||:..|.
  Fly   359 LVEGIFSMEGSIVRLPEVIALKKKYKAYLYLDEAHSVGAMGSRGRGVTDYFNVDPKEVDILMGTF 423

  Fly   262 GKALGGASGGYTTGPAELISFLRQKSRPYLFSNTLPPAVVAVGLKVMDMLLQSS------ELTQR 320
            .|:.|.| |||..|..:||.|||..|..:.::.::.|.:....|..|..::...      :...:
  Fly   424 TKSFGSA-GGYLAGSKKLIDFLRTNSHAHCYAASISPPIAQQILTSMKTIMGEDGTDIGRKKIHQ 487

  Fly   321 VQSNTQRFRQAMTKAG-FTIAGENHPICPVMLGDARLASQFADEMLTRGIYVIGFSYPVVPQGKA 384
            :..||:.||:.:.:.| .|...|:.|:.|:::............:.||.|..:|..:|..|..:.
  Fly   488 LARNTRYFRRRLAQLGVITYGHEDSPVVPMLVYLFSKIGAVVRTLTTRHIAAVGAGFPATPIMEG 552

  Fly   385 RIRVQISAAHTEAEIDRAINAFIEVGRSL 413
            |||..:|||||:.::|.|:.|..|:...|
  Fly   553 RIRFCLSAAHTKEQLDFALEAIDEIADDL 581

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10361NP_648509.1 PRK06939 19..416 CDD:235893 122/419 (29%)
BioF 30..410 CDD:223234 120/403 (30%)
laceNP_001285957.1 PLN02483 117..587 CDD:178101 123/420 (29%)
BioF 164..577 CDD:223234 122/414 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108905534
eggNOG 1 0.900 E1_COG0156
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D312139at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13693
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.