DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10361 and Alas1

Sequence 1:NP_648509.1 Gene:CG10361 FlyBaseID:FBgn0036208 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001278764.1 Gene:Alas1 MGIID:87989 Length:642 Species:Mus musculus

Alignment Length:400 Identity:139/400 (35%)
Similarity:224/400 (56%) Gaps:31/400 (8%)


  Fly    38 KDAGTFKAERIITSSQSTQITVQGSD--------KKILNFCANNYLGLANNPEIVEHSQKLLEQY 94
            |:..|::..:  |.::..||.....|        |::..:|:|:|||::.:|.:.....:.::|:
Mouse   213 KNDHTYRVFK--TVNRRAQIFPMADDYTDSLITKKQVSVWCSNDYLGMSRHPRVCGAVMETVKQH 275

  Fly    95 GAGLSSVRFICGTQDIHKQLEKKIAQFHGREDTILYASCFDAN-AGIFE-AILTPEDAVFSDELN 157
            |||....|.|.||...|.:||:.:|..||::..:|::|||.|| :.:|. |.:.|...::||..|
Mouse   276 GAGAGGTRNISGTSKFHVELEQALADLHGKDAALLFSSCFVANDSTLFTLAKMMPGCEIYSDSGN 340

  Fly   158 HASIIDGIRLCKAKKQRYRHRDLGDLEEQLKASDARL-KLIATDGVFSMDGNIAPLARIVELARK 221
            |||:|.|||..:..|..:||.|:..|.|.|:.||..: |::|.:.|.||||.:.||..:.::|.:
Mouse   341 HASMIQGIRNSRVPKYIFRHNDVNHLRELLQRSDPSVPKIVAFETVHSMDGAVCPLEELCDVAHE 405

  Fly   222 YNALVFVDECHATGFFGATGRGTEEYDNVMGEVDIINSTLGKALGGASGGYTTGPAELISFLRQK 286
            :.|:.||||.||.|.:||.|.|..:.|.||.::|||:.|||||. |..|||....:.||..:|..
Mouse   406 FGAITFVDEVHAVGLYGARGGGIGDRDGVMPKMDIISGTLGKAF-GCVGGYIASTSLLIDTVRSY 469

  Fly   287 SRPYLFSNTLPPAVVAVGLKVMDMLLQSSE---LTQRVQSNTQRFRQAMTKAGFTIAGENHPICP 348
            :..::|:.:|||.::|..|:.: .:|:|||   |.::.|.|.:..||.:..||..:......|.|
Mouse   470 AAGFIFTTSLPPMLLAGALESV-RILKSSEGRALRRQHQRNVKLLRQMLMDAGLPVIHCPSHIIP 533

  Fly   349 VMLGDARLASQFADEMLTR-GIYVIGFSYPVVPQGKARIRVQISAAHTEAEIDRAINAFIE---- 408
            |.:.||...::..||::|| .|||...:||.||:|:..:|:..:..||    .:.:|.|:|    
Mouse   534 VRVADAAKNTEICDELMTRHNIYVQAINYPTVPRGEELLRIAPTPHHT----PQMMNFFVEKLLV 594

  Fly   409 ----VGRSLK 414
                ||..||
Mouse   595 TWKRVGLELK 604

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10361NP_648509.1 PRK06939 19..416 CDD:235893 139/400 (35%)
BioF 30..410 CDD:223234 136/395 (34%)
Alas1NP_001278764.1 Preseq_ALAS 2..140 CDD:286162
AAT_I 199..604 CDD:302748 138/399 (35%)
BioF 199..600 CDD:223234 136/395 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0156
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126783
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R554
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.