DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dnai2 and dync1i2a

Sequence 1:NP_001261723.1 Gene:Dnai2 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_017213212.2 Gene:dync1i2a ZFINID:ZDB-GENE-060929-1086 Length:626 Species:Danio rerio

Alignment Length:603 Identity:126/604 (21%)
Similarity:226/604 (37%) Gaps:150/604 (25%)


  Fly     6 KKERRSFGARVHFEDKDEVVFTENSNPE--------LVKSYILKNPVDRVTQYAGQTSLSVANTE 62
            ::||:...|.:   .||.|...::|:.|        |::|..:.:.|.........|:.||.:..
Zfish    29 EEERKKKEAEL---KKDAVPLQDDSDLEKKRREADALLQSMGITSDVSAAPAPMSPTAKSVGSPS 90

  Fly    63 RATYKSTG------------------ITHNE-GGWPKDINM-------HDPEQTVRY-------- 93
            .|..:.:|                  :.|:| |..|..:.|       ..|::.|.|        
Zfish    91 EAGSQDSGDGTTGPRTLHWDCDPSTVLLHSELGRGPLKLAMTKMTHVDFPPKEVVSYTKETQTPT 155

  Fly    94 --KRKIEKDENYITQV------MNLTKPME--------HYIHQNNAVNIY--ENYFENLDPAP-L 139
              ::|.|:||...|..      ....||.|        |.:.:...:.|.  |.:.:..|.:. :
Zfish   156 MTEQKDEEDEEEETPAAQPEAETEKEKPEEKQVEEALPHELTEEEKLQILHSEEFMDFFDHSTRI 220

  Fly   140 PEPCKSRTVNVYRDPNPIKVPVKHLSWSPDGGIKMAVSHCDMRFQGDK-SNQK---C-------- 192
            .|...|..|:|:.|.:...:..|  ......|.|::::.   :|..|: |.|:   |        
Zfish   221 VERALSEHVDVFFDYSGRDMEEK--EGEMQAGTKLSLNR---KFVDDRWSKQRVVTCLDWSPQYP 280

  Fly   193 ----NSYIWEVENPNEPFLTLEPKVPCVCLEYNQK------------------------DPTSLV 229
                .||....|.|:||        ..|.|.:|.|                        .|..:|
Zfish   281 ELLVASYNNNEEAPHEP--------DGVALVWNMKYKKATPEYVFHCQSAVMSAAFAKFHPNLVV 337

  Fly   230 SGMYNGQVAAWDTR-HGKLPVMISE-REVCHRDPVNSVLWNNSKSGTEFFSGGSDGQVLWWDTRK 292
            .|.|:||:..||.| :.:.||..:. ....|..||..|....:::.....|..:||::..|....
Zfish   338 GGTYSGQIVLWDNRSNRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKMCSWSLDM 402

  Fly   293 LTEPLDRLLMDPVKSDDQDL----SRSYGISVLEYETTIPTRFMAGTEMGMLFSCNRKGKTPTEK 353
            |::|          .|..:|    |:|..::.:.:.......|:.|:|.|.:::.:|.|    .:
Zfish   403 LSQP----------QDSMELVFKQSKSVAVTSMSFPLGDVNNFVVGSEDGSVYTASRHG----SR 453

  Fly   354 IQIRMMC--HLGPVYAITRNPA-----FVKNFLTVG-DWCARIWSEDCRESSIIWT-KSSSSMLT 409
            ..|..|.  |.||:..|..:.|     |...|||.. ||..::||.  :.:..::: :.:|..:.
Zfish   454 AGISEMFEGHHGPITGIHCHTAAGPVDFSHLFLTASFDWTVKLWSN--KNNKPLYSFEDNSDYVY 516

  Fly   410 DGAWSYTKVSQFFITRMDGVLDTWDLLQQQNEPVLTVKVCDEP-LYCVRTNENGKFVSCGSQLGA 473
            |..||....:.|......|.:|.|:|......|..:|.|...| |..:|.:::|:.::.|...|.
Zfish   517 DVMWSPVHPALFACVDGLGRVDLWNLNNDTEVPTASVAVDGSPALNRLRWSQSGREIAVGDSEGQ 581

  Fly   474 TFLVEVSDNMVMSAKNDK 491
            ..:.:|.:.:.: .:||:
Zfish   582 IHIYDVGEQIAV-PRNDE 598

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 83/378 (22%)
WD40 repeat 162..208 CDD:293791 14/62 (23%)
WD40 212..469 CDD:295369 67/297 (23%)
WD40 repeat 215..254 CDD:293791 15/65 (23%)
WD40 repeat 262..304 CDD:293791 8/42 (19%)
WD40 repeat 318..355 CDD:293791 6/37 (16%)
WD40 repeat 365..401 CDD:293791 10/42 (24%)
WD40 repeat 408..433 CDD:293791 6/25 (24%)
dync1i2aXP_017213212.2 Dynein_IC2 126..154 CDD:314442 5/28 (18%)
WD40 269..586 CDD:330360 75/341 (22%)
WD40 repeat 270..317 CDD:293791 11/55 (20%)
WD40 repeat 324..363 CDD:293791 11/39 (28%)
WD40 repeat 372..415 CDD:293791 10/53 (19%)
WD40 repeat 423..461 CDD:293791 8/42 (19%)
WD40 repeat 470..509 CDD:293791 10/41 (24%)
WD40 repeat 515..542 CDD:293791 7/27 (26%)
WD40 repeat 561..587 CDD:293791 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.