DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dnai2 and dync1i2b

Sequence 1:NP_001261723.1 Gene:Dnai2 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_009300385.1 Gene:dync1i2b ZFINID:ZDB-GENE-090121-1 Length:645 Species:Danio rerio

Alignment Length:563 Identity:121/564 (21%)
Similarity:217/564 (38%) Gaps:111/564 (20%)


  Fly    13 GARVHFEDKDEVVFTENSNPELVKSYILKNPVDRVTQ--YAGQTSLSVANTERATYKSTGITHNE 75
            |.|....|.|......:|:.:|.:. .||..:.:|||  :..:..:|.:   :.|...|...|.|
Zfish   120 GPRTLHWDSDPSTLLLHSDSQLGRG-PLKLGMSKVTQVDFPPKEMVSYS---KETQTPTQTHHKE 180

  Fly    76 G-GWPKDINMHDPEQTVRYKRKIEKDENYITQVMNLTKPMEHYIHQNNAVNIYENYFENLDPAPL 139
            . ...:|:.:..|....:.::..:|:|:..:......:..:..:|....|..:::      .:.:
Zfish   181 DEEEEEDLAVMQPVMEPQEEKDSQKEEDEASPHELTEEEKQQILHSEEFVTFFDH------SSRI 239

  Fly   140 PEPCKSRTVNVYRDPN-------------PIKVPV----------KH-----LSWSPDGGIKMAV 176
            .|...|..|:|:.|.:             ..|:.:          ||     |.|||.....:..
Zfish   240 MERALSEQVDVFFDYSGRDLQDKEGESQAGAKLSLNRQFADERWSKHRVVTCLDWSPQYPELLVA 304

  Fly   177 SHCDMRFQGDKSNQKCNSYIWEVENPNEP----------FLTLEPKVPCVC------LEYNQKDP 225
            |:|        ||:         |.|:||          :....|:....|      ..:.|..|
Zfish   305 SYC--------SNE---------EAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSAAFAQFHP 352

  Fly   226 TSLVSGMYNGQVAAWDTRHGK-LPVMISEREV-CHRDPVNSVLWNNSKSGTEFFSGGSDGQVLWW 288
            ..:|.|.|:||:..||.|..| .||..:.... .|..||..|....:::.....|..:||::..|
Zfish   353 NLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSASAHTHPVYCVNVVGTQNAHNLISISTDGKMCSW 417

  Fly   289 DTRKLTEPLDRLLMDPVKSDDQDL----SRSYGISVLEYETTIPTRFMAGTEMGMLFSCNRKGKT 349
            ....|:.|.|.|          :|    |:|..::.:.:.......|:.|:|.|.:::..|.|  
Zfish   418 SLDMLSTPQDSL----------ELVFKQSKSVAVTSMSFPLGDVNNFVVGSEDGSVYTACRHG-- 470

  Fly   350 PTEKIQIRMMC--HLGPVYAITRNPA-----FVKNFLTVG-DWCARIWSEDCRESSIIWT-KSSS 405
              .|..|..|.  |.||:..:..:.|     |...|:|.. ||..::||  .:.:..::: :.:|
Zfish   471 --SKAGISEMFEGHHGPITGLDCHTAAGPVDFSHLFVTSSFDWTVKLWS--TKNNKPLYSFEDNS 531

  Fly   406 SMLTDGAWSYTKVSQFFITRMDGV--LDTWDLLQQQNEPVLTVKVCDEP-LYCVRTNENGKFVSC 467
            ..:.|..||.|..:.|  ..:|||  ||.|:|..:...|..:|.|...| |..||...:|:.|:.
Zfish   532 DYVYDVMWSPTHPALF--ACVDGVGHLDLWNLNNETEVPTASVTVEGNPALNRVRWAHSGREVAV 594

  Fly   468 GSQLGATFLVEVSDNMVMSAKND-KPLLTAMFERENRREKILE 509
            |...|...:.:|.:.:.:..::: ...:..:.|....||.:.|
Zfish   595 GDSEGQLHIYDVGEQISVPRQDEWTRFVRTLTEINENREDVEE 637

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 89/371 (24%)
WD40 repeat 162..208 CDD:293791 14/61 (23%)
WD40 212..469 CDD:295369 72/281 (26%)
WD40 repeat 215..254 CDD:293791 14/46 (30%)
WD40 repeat 262..304 CDD:293791 10/42 (24%)
WD40 repeat 318..355 CDD:293791 7/37 (19%)
WD40 repeat 365..401 CDD:293791 8/42 (19%)
WD40 repeat 408..433 CDD:293791 10/27 (37%)
dync1i2bXP_009300385.1 Dynein_IC2 145..173 CDD:288403 7/31 (23%)
Spore_coat_CotO 153..>256 CDD:290858 19/112 (17%)
WD40 283..605 CDD:295369 88/357 (25%)
WD40 repeat 289..338 CDD:293791 13/66 (20%)
WD40 repeat 343..382 CDD:293791 13/39 (33%)
WD40 362..>606 CDD:225201 67/262 (26%)
WD40 repeat 391..434 CDD:293791 11/53 (21%)
WD40 repeat 442..490 CDD:293791 12/52 (23%)
WD40 repeat 497..528 CDD:293791 7/33 (21%)
WD40 repeat 534..575 CDD:293791 15/43 (35%)
WD40 repeat 580..606 CDD:293791 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.