DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dnai2 and dnai1.2

Sequence 1:NP_001261723.1 Gene:Dnai2 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001074027.1 Gene:dnai1.2 ZFINID:ZDB-GENE-070112-1302 Length:660 Species:Danio rerio

Alignment Length:558 Identity:112/559 (20%)
Similarity:203/559 (36%) Gaps:113/559 (20%)


  Fly    16 VHFEDKDEVVFTEN----------------SNPELVKSYILK------------NPVDRVTQYAG 52
            :|||.:..:|..|:                ...|.:::..:|            |.:||.:|...
Zfish   111 IHFELEGNLVHKESDEGRRLMAKHTEREDCGGDERLENVPIKPGKREQKVTNQFNFIDRASQTLN 175

  Fly    53 QTSLSVA-NTE---RATYKSTG------------ITHNEGGWPKDINMHDPEQTVRYKRKIEKDE 101
            .....:: .||   ||.:.:|.            :...|....|..:....::..|.|:|:.:.|
Zfish   176 NLPREISCQTEPPPRANFSATANQWEIYDFYVEELQRREKSKEKQESQFPNKEEDRSKKKMIQAE 240

  Fly   102 NYITQVMNLTKP---MEHYIHQNNAVNIYEN--YFENLDPAPLPEPCKSRTVNVYRDPNPIKVPV 161
            .....:..|.||   :|..::||....:.::  |||:             ..:.:|......:|:
Zfish   241 AQSDDISQLAKPAEIIERMVNQNIFDEVAQDFMYFED-------------AADEFRGEKGTLLPL 292

  Fly   162 KHLSWSPDGGIKMAVSHCDMRFQGDKSNQKCNSY-----------IWEVENPNEPFLTLEPKVPC 215
            ....:....|:.: .:.|......|.......||           .:.::||:.|..........
Zfish   293 WKFQYDKAKGLSV-TALCWNHIYSDLFAVGLGSYEFTQQERGMLLFYTLKNPSFPEFIFNTDSGV 356

  Fly   216 VCLEYNQKDPTSLVSGMYNGQVAAWDTR-------------HGKLPVMISEREVCHRDPVNSVLW 267
            :|::.:::....:..|:|:|.|:.:|.|             .||           |...|..|.|
Zfish   357 MCVDIHEQLSYLVAVGLYDGCVSVYDLRKKSDQPMYNSIASSGK-----------HTGAVWQVKW 410

  Fly   268 --NNSKSGTEFFSGGSDGQVLWWDTRK----LTEPLDRLLMDPVKSDDQDLSRSYGISVLEYETT 326
              ::..|...|||..:||:|:.|...|    .|:.:....:|.|..|.:::..:.|.| |::...
Zfish   411 QKDDLDSNHNFFSVSTDGRVVSWTLVKHEIVFTDIIKLPPVDKVPDDLKNVVATAGTS-LDFHKQ 474

  Fly   327 IPTRFMAGTEMGMLFSCNRKGKTPTEKIQIRMMCHLGPVYAITRNPAFVKNFLTVG-DWCARIWS 390
            ....|:.|||.|.:   ::..|..:.|.......|...|..:..||.....|::.| ||..:|| 
Zfish   475 KDHHFLVGTEAGKI---HKGSKYYSSKFLEMYDAHFMTVSCVRWNPFHPNVFISCGWDWMVKIW- 535

  Fly   391 EDCRESSIIWTKSSSSMLTDGAWSYTKVSQFFITRMDGVLDTWDLLQQQNEPVLTVKVCDEP--L 453
             |...:|.::|....|.:||.|||....:.|.....||.:..:||...:.|.:...||..:.  |
Zfish   536 -DHTINSPVFTFELKSSVTDVAWSPHSSTVFAAVTADGKVHVFDLSINKYEALCQQKVVSKKTRL 599

  Fly   454 YCVRTNENGKFVSCGSQLGATFLVEVSDNMVMSAKNDK 491
            ..:..|.....:..|...|....:::|.|:....|..|
Zfish   600 LHIEFNPVHPIIIVGDDRGRVISLKLSPNLRKKPKEKK 637

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 77/355 (22%)
WD40 repeat 162..208 CDD:293791 8/57 (14%)
WD40 212..469 CDD:295369 66/279 (24%)
WD40 repeat 215..254 CDD:293791 9/52 (17%)
WD40 repeat 262..304 CDD:293791 14/48 (29%)
WD40 repeat 318..355 CDD:293791 9/37 (24%)
WD40 repeat 365..401 CDD:293791 11/37 (30%)
WD40 repeat 408..433 CDD:293791 8/25 (32%)
dnai1.2NP_001074027.1 WD40 <296..650 CDD:225201 79/361 (22%)
WD40 354..620 CDD:295369 67/283 (24%)
WD40 repeat 357..397 CDD:293791 7/40 (18%)
WD40 repeat 405..485 CDD:293791 23/81 (28%)
WD40 repeat 511..547 CDD:293791 11/38 (29%)
WD40 repeat 552..591 CDD:293791 11/39 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.