DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dnai2 and Wdr34

Sequence 1:NP_001261723.1 Gene:Dnai2 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001005542.2 Gene:Wdr34 RGDID:1359465 Length:537 Species:Rattus norvegicus

Alignment Length:518 Identity:106/519 (20%)
Similarity:198/519 (38%) Gaps:105/519 (20%)


  Fly    55 SLSVANTERATYKSTGITHNEGGWPKDINMHDPEQ-----------TVRYKRKIEKDENYITQVM 108
            |...|....|...:...||.:.    .:....||:           |:|....:.:.|..:.:.:
  Rat    64 SCQTAGIATAEASAQARTHADA----QVQTEAPEEPAAVAPVSQYDTLRLAAFLRRVEAMVVREL 124

  Fly   109 NLTKPMEHYIHQNNAVNIYE-NYFENLDPAPLPEPCKSRTVNV-----YRDPNPIKVPVKHLSWS 167
            |..       .|::|.:.|| |:.|           :.:||:.     |.......:.|..:||:
  Rat   125 NNN-------WQSHAFDGYEVNWTE-----------QQQTVSCLHTLGYPPAQGQGLHVTGISWN 171

  Fly   168 PDGGI-KMAVSHCDMRFQGDKSNQKCNSYI--WEVE----NPNEPFLTLEPKVPCVCLEYNQKDP 225
            ..|.: ..|....|   .||....|  ||:  |.::    ||::|.:.:|.....:||.::...|
  Rat   172 TTGSVLACAYGRLD---DGDWGTLK--SYVCTWNLDRQGLNPHQPSVVVEVPSAVMCLAFHPIQP 231

  Fly   226 TSLVSGMYNGQVAAWDTRHGKLPVM--ISEREVCHRDPVNSVLWNNSKSGTEFF---SGGSDGQV 285
            :.:..|:|:|:|..||....:.|::  ....:..|.|||..|||......:..|   |..:||:|
  Rat   232 SHIAGGLYSGEVLVWDMSRPEDPLLWRTGLTDDTHTDPVYQVLWLPEPRHSHRFQVLSAATDGRV 296

  Fly   286 LWW-----DTRKLTE---------PLDRLLMDPVKSDDQDLSRSYGISVLEYETTIPTRFMAGTE 336
            |.|     ...:|::         |....|..|.:.:.:     .|::.:.:.:...:.|:.|||
  Rat   297 LLWRGSGAGQLRLSKGFALAVQQLPRSTKLKKPPRGETE-----VGVTSVAFSSFDSSLFVLGTE 356

  Fly   337 MGMLFSCNRKG------KTPTE-----KIQIRMMCHLGPVYAITRNPAFVKNFLTVG-DWCARIW 389
            .|....|:...      :.|:.     .:|.....|.||||:::.:|.....||:.| |....::
  Rat   357 GGFPLKCSLAAEAAALTRMPSSVPLRAPVQFTFSPHGGPVYSVSCSPFHRNLFLSAGTDGHVHLY 421

  Fly   390 SEDCRESSIIWTKSSSSMLTDGAWSYTKVSQFFITRMDGVLDTWDLLQQQNEPVLTVKVCDE--P 452
            |. .:...:...:.|...|....||..:...|.....:|.:..:||.:...:|.:::....:  |
  Rat   422 SM-LQAQPLTSLQLSHKYLFAVRWSPVRPLVFAAASGEGDVQLFDLQKSSQKPTVSITQTQDGSP 485

  Fly   453 LYCVRTN-ENGKFVSCGSQLGATFLVEVSDNMVMSAKNDKPLLTAMFERENRREKILEAKSRE 514
            :||:..| :..:.::.|...|...:.::|              ||..|:..|..:.|:....|
  Rat   486 VYCLEFNSQQTQLLAAGDAKGVVKVWQLS--------------TAFTEQGPREAEDLDQLEAE 534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 80/363 (22%)
WD40 repeat 162..208 CDD:293791 14/53 (26%)
WD40 212..469 CDD:295369 62/291 (21%)
WD40 repeat 215..254 CDD:293791 10/41 (24%)
WD40 repeat 262..304 CDD:293791 14/59 (24%)
WD40 repeat 318..355 CDD:293791 7/48 (15%)
WD40 repeat 365..401 CDD:293791 8/37 (22%)
WD40 repeat 408..433 CDD:293791 5/25 (20%)
Wdr34NP_001005542.2 WD40 101..515 CDD:225201 93/457 (20%)
WD40 repeat 165..211 CDD:293791 14/51 (27%)
WD40 218..515 CDD:295369 64/317 (20%)
WD40 repeat 223..265 CDD:293791 10/42 (24%)
WD40 repeat 271..309 CDD:293791 10/38 (26%)
WD40 repeat 339..389 CDD:293791 8/50 (16%)
WD40 repeat 396..433 CDD:293791 8/38 (21%)
WD40 repeat 439..479 CDD:293791 8/40 (20%)
WD40 repeat 486..511 CDD:293791 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.