DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dnai2 and Sdic2

Sequence 1:NP_001261723.1 Gene:Dnai2 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001285481.1 Gene:Sdic2 FlyBaseID:FBgn0053497 Length:543 Species:Drosophila melanogaster

Alignment Length:444 Identity:104/445 (23%)
Similarity:188/445 (42%) Gaps:69/445 (16%)


  Fly    80 KDINMHDPEQTVRYKRKIEKDENYITQVMNLTKPMEHYIHQNNAVNIYENYFENLDPAPL-PEPC 143
            |::|....||    |:.|...||:...|:...:.:|..:.:|  |:||.:|....|.... .|..
  Fly   117 KEVNELSEEQ----KQMIILSENFQRFVVRAGRVIERALSEN--VDIYTDYIGGGDSEEANDERS 175

  Fly   144 KSR-TVN-VYRDPNPIKVP-VKHLSWSPDGGIKMAVSHCDMRFQGDKSNQKCNSYIWEVENPNEP 205
            .:| ::| |:.|....|.. :..:.||         :|......|...|.:        |:||||
  Fly   176 HARLSLNRVFYDERWSKNRCITSMDWS---------THFPELVVGSYHNNE--------ESPNEP 223

  Fly   206 ----------FLTLEPK--------VPCVCLEYNQKDPTSLVSGMYNGQVAAWDTR-HGKLPVMI 251
                      |....|:        |...|  :.:.:|..::.|.|:||:..||.| ..:.|:..
  Fly   224 DGVVMVWNTKFKKSTPEDVFHCQSAVMSTC--FAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQR 286

  Fly   252 SE-REVCHRDPVNSVLWNNSKSGTEFFSGGSDGQVLWWDTRKLTEPLDRLLMDPVKSDDQDLSRS 315
            :. ....|..||..:....:::.....|..|||::..|....|::|.|.|.:      .|..|::
  Fly   287 TPLSAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLDMLSQPQDTLEL------QQRQSKA 345

  Fly   316 YGISVLEYETTIPTRFMAGTEMGMLFSCNRKG-KTPTEKIQIRMMCHLGPVYAITR-----NPAF 374
            ..|:.:.:........:.|:|.|.::|.:|.| ::...::..|   ||||:..|:.     :|.|
  Fly   346 IAITSMAFPANEINSVVMGSEDGYVYSASRHGLRSGVNEVYER---HLGPITGISTHYNQLSPDF 407

  Fly   375 VKNFLTVG-DWCARIWSEDCRESSIIWT-KSSSSMLTDGAWSYTKVSQFFITRMDGVLDTWDLLQ 437
            ...|||.. ||..::||  .:::..::: :.:|..:.|.|||....:.|......|.||.|:|.|
  Fly   408 GHLFLTSSIDWTIKLWS--LKDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDGSGRLDLWNLNQ 470

  Fly   438 QQNEPVLTVKVCDEP-LYCVRTNENGKFVSCGSQLGATFLVEVSDNMVMSAKND 490
            ....|..::.|...| |..|....:|..|..|.:.|..::.:|::|:...::::
  Fly   471 DTEVPTASIVVAGAPALNRVSWTPSGLHVCIGDEAGKLYVYDVAENLAQPSRDE 524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 81/352 (23%)
WD40 repeat 162..208 CDD:293791 11/56 (20%)
WD40 212..469 CDD:295369 67/276 (24%)
WD40 repeat 215..254 CDD:293791 10/41 (24%)
WD40 repeat 262..304 CDD:293791 10/42 (24%)
WD40 repeat 318..355 CDD:293791 7/38 (18%)
WD40 repeat 365..401 CDD:293791 10/42 (24%)
WD40 repeat 408..433 CDD:293791 8/25 (32%)
Sdic2NP_001285481.1 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 17/67 (25%)
WD40 196..512 CDD:295369 80/346 (23%)
WD40 repeat 196..245 CDD:293791 12/66 (18%)
WD40 <224..523 CDD:225201 72/312 (23%)
WD40 repeat 251..289 CDD:293791 10/40 (25%)
WD40 repeat 298..337 CDD:293791 10/39 (26%)
WD40 repeat 349..435 CDD:293791 21/91 (23%)
WD40 repeat 441..479 CDD:293791 12/38 (32%)
WD40 repeat 487..513 CDD:293791 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C60923763
eggNOG 1 0.900 E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12442
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.