DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dnai2 and Wdr60

Sequence 1:NP_001261723.1 Gene:Dnai2 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_006515843.1 Gene:Wdr60 MGIID:2445085 Length:1033 Species:Mus musculus

Alignment Length:546 Identity:98/547 (18%)
Similarity:171/547 (31%) Gaps:159/547 (29%)


  Fly    43 PVDRVTQYAGQTSLSVANTERATYKSTGITHNEGGWPKDI-----------NMHDPEQTVRYKRK 96
            ||:....|       :.|..:...|...:.:||....:||           ..|..|.|......
Mouse   489 PVNEYDMY-------IRNFGKKNTKQAYVQYNEDNVERDIQTEDIETREVWTQHPGEGTAVSGGS 546

  Fly    97 IEKDENYITQVMNLTKP-MEHYIH-------------------------QNNAVNIYENYFENLD 135
            .|||.:.:|.|..:..| :.:::.                         |:.|:||.::..:...
Mouse   547 EEKDFSDVTVVPKIDTPRLANFLRAACQVVAVLLEEDRLAAGPSWIPRAQDKALNISDSSSQLNT 611

  Fly   136 PAPLPEPCKSRTVNVYRDPNPIKVPVKHLSWSPDGGIKMAVSHCDMRFQGDKSNQKCNSYIWEVE 200
            ..|..:..|...::..|......|.|..|   |:.....::         |..:..|   :|::.
Mouse   612 SLPFLQSRKVSCLHASRVQRQTVVSVHDL---PEKAFAPSL---------DSRHLLC---VWDIW 661

  Fly   201 NPNEP--FLTLEPKVPCVCLEYNQKDPTSLVSGMYNGQVAAWDTRHG----------------KL 247
            .|:.|  .|..|.||.|.|  ::......|.:|..:|.|..||.|..                :.
Mouse   662 QPSGPQKVLICESKVTCCC--FSPLKAFLLFAGTVHGSVVVWDLREDSRIHHYVRLSNCFWAFRT 724

  Fly   248 PVMISE---REVCHRDPVNSV------------------LWNNSKSGTEFFSGGSD--GQVLWWD 289
            |...::   ..|.||.|:.::                  ......:|..|.....|  |.:..|.
Mouse   725 PTFSTDGILTSVNHRSPLQAIEPVATSAYKKQSFVLSPFSTQEEMAGLSFHIASLDETGVLNVWV 789

  Fly   290 TRKLTE-------------PLDRL---------LMDPVKSDDQDLSRSYGISVLEYETTIPTRFM 332
            ..:|.:             |..|:         |.:.:...|.:|..|.....:::..:.|..|:
Mouse   790 VVELPKADISGSMSDLGLIPGGRIKLVHSTVIQLGNSLSHKDSELWGSTQTLSVKFLPSDPNHFV 854

  Fly   333 AGTEMGML--------------FSCNRKGKTPTEKIQIRMMCHLGPVYAITRNPAFVKNFLTVG- 382
            .||:||::              |...:.|..|.:            |..|..:| |.:.....| 
Mouse   855 VGTDMGLISHSTRQDWRVSPRVFKPEQHGVRPIK------------VNVIDFSP-FEETVFLAGC 906

  Fly   383 -DWCARIWSEDCRESSIIWTKSSSS-MLTDGAWSYTKVSQFFITRMDGVLDTWDLLQQQNEPVLT 445
             |...|:.........:.|..|:|. .:|...||.|:.:.|.:......:..||||:....||..
Mouse   907 SDGSIRLHQLTSERPIMQWDNSTSGHAVTSLQWSPTRPAVFLVQDDASRIYVWDLLENDLGPVAQ 971

  Fly   446 VKVCDEPLYCVR-----TNENGKFVS 466
            ..:..:.|..:.     ...:|.||:
Mouse   972 QPISPDKLVAMTIVGEPEKTSGSFVA 997

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 72/393 (18%)
WD40 repeat 162..208 CDD:293791 8/48 (17%)
WD40 212..469 CDD:295369 62/339 (18%)
WD40 repeat 215..254 CDD:293791 10/58 (17%)
WD40 repeat 262..304 CDD:293791 9/84 (11%)
WD40 repeat 318..355 CDD:293791 9/51 (18%)
WD40 repeat 365..401 CDD:293791 8/38 (21%)
WD40 repeat 408..433 CDD:293791 5/25 (20%)
Wdr60XP_006515843.1 PRP38_assoc 86..167 CDD:289628
WD40 604..1000 CDD:225201 76/425 (18%)
WD40 repeat 635..671 CDD:293791 10/51 (20%)
WD40 673..961 CDD:295369 55/303 (18%)
WD40 repeat 676..708 CDD:293791 10/34 (29%)
WD40 repeat 715..752 CDD:293791 5/37 (14%)
WD40 repeat 759..788 CDD:293791 4/29 (14%)
WD40 repeat 842..878 CDD:293791 7/36 (19%)
WD40 repeat 890..926 CDD:293791 7/37 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.