DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dnai2 and wdr-60

Sequence 1:NP_001261723.1 Gene:Dnai2 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_498058.2 Gene:wdr-60 WormBaseID:WBGene00016165 Length:673 Species:Caenorhabditis elegans

Alignment Length:613 Identity:126/614 (21%)
Similarity:201/614 (33%) Gaps:196/614 (32%)


  Fly     7 KERRSFG------ARVHFEDKDEVVFTE---------NSNPELVKSYILKNPVDRVTQYAGQTSL 56
            :|:|:||      ..:..|.....|||:         ||.|        .|....:||.......
 Worm   155 QEQRAFGRLNKLRGLISIEVTKSQVFTDLSSNIFEPFNSLP--------SNKSHALTQTGKDCHT 211

  Fly    57 SVANTER--ATYKSTGITHNEG-----GWPKDINMHD----------PEQTVR-----YKRKIEK 99
            ....|||  ...|.|...|:|.     |..|:....|          ..||:|     ..:..|:
 Worm   212 EEVQTERGETEEKETQCPHSESTRIEDGIEKERTSTDRARLKKFFFAATQTIREILISEDKSAEE 276

  Fly   100 DEN---------------YITQVMNLTKPMEHYIHQNNAVNIYENYFENLDPAPLPEPC-KSRTV 148
            ||.               .:.||:..:|.......::::|.:....||    :|.|:.. ||..|
 Worm   277 DETREKSISKFSRGYNPFRLCQVVTKSKSTCIRKGESDSVLVAYEIFE----SPAPDLINKSLIV 337

  Fly   149 NVY----RDPNPIKVPVKHLSWSPDGGIKMAVSHCDMRFQGDKSNQKCNSYIWEVENPNEPFLTL 209
            ..:    |.|..:.|            ::..||..::    .:|:|                   
 Worm   338 EFFVHKRRPPKRLFV------------VESIVSVMEL----SQSSQ------------------- 367

  Fly   210 EPKVPCVCLEYNQKDPTSLVSGMYNGQVAAWDTR------HGKLPVMISEREVCHR--------- 259
               :..|||              .:|...|:|..      ...||.:.||..:..|         
 Worm   368 ---ILYVCL--------------MDGTFCAFDLSITDAFFDDNLPWVDSETNIALRRPTFDSSFL 415

  Fly   260 -------DPVNSVLWNNSKSGTEFFSGGSDGQVLWWDTRKLTEPLDRLLMDPVKSDDQDLSR--- 314
                   .|:..:....|..|.|..:..:.|.:.:|...::.:...|||:..|......|.|   
 Worm   416 ATTVSDATPLIGIALGKSSVGEEITTIDTAGTISYWIANRVEKNELRLLLTAVIRPHPVLKRHST 480

  Fly   315 SYGISVLEYETTIPTRFMAGTEMGMLFSCNRKG---------KTPTEKIQIRMMCHLGPVYAITR 370
            |:.:|...:.|. |.||..||:.|||:|..:..         ||..||        .|.|..|..
 Worm   481 SFAVSAFCHVTN-PLRFFIGTDTGMLYSMYKSDTSQAIPKIYKTEKEK--------YGEVTVIAA 536

  Fly   371 NPA--------FVKNFLTVGDWCARIWSEDCRESSI--IWTKSSSSMLTDGAWSYTKVSQFFITR 425
            ||:        |....::|        ....:.|||  |.|...|:.:|..:||.|..|.|:...
 Worm   537 NPSDNTVLIVGFSNGSISV--------YRTTQASSIVNIPTADLSTRVTWISWSLTNPSGFYTIH 593

  Fly   426 MDGVLDTWDLLQQQNEPVLTVKVCDEPLYCVRTNENGKFVSCGSQLG-ATFLVEVSDNMVMSAKN 489
            ...::..|||..:     |:.|..|.....|:...:..::|..:::| ..|.:...|:.|...::
 Worm   594 NSNIITYWDLGFK-----LSPKSVDHRTDSVQVLASDTWLSENAKIGYMAFGLSNGDSEVHVLED 653

  Fly   490 DKPLLTAMFERENRREKILEAKSRESKL 517
            .        .|:|:.|.|||...|...|
 Worm   654 P--------ARKNQNETILEVLRRIKNL 673

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 73/367 (20%)
WD40 repeat 162..208 CDD:293791 4/46 (9%)
WD40 212..469 CDD:295369 66/301 (22%)
WD40 repeat 215..254 CDD:293791 10/45 (22%)
WD40 repeat 262..304 CDD:293791 8/42 (19%)
WD40 repeat 318..355 CDD:293791 15/46 (33%)
WD40 repeat 365..401 CDD:293791 10/46 (22%)
WD40 repeat 408..433 CDD:293791 6/25 (24%)
wdr-60NP_498058.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.