DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dnai2 and wdr63

Sequence 1:NP_001261723.1 Gene:Dnai2 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001120428.1 Gene:wdr63 XenbaseID:XB-GENE-980327 Length:896 Species:Xenopus tropicalis

Alignment Length:727 Identity:151/728 (21%)
Similarity:260/728 (36%) Gaps:210/728 (29%)


  Fly     1 MEYIFKKERRSFGARVHFEDKDEVVFTENSNPELVKSYILKNPVDRVTQYAGQTSLSVANTERAT 65
            ::::..:.:|.|||:|:|.|       .|::.       :|:.....|.|..: ..|:...||.|
 Frog   193 IKFMISRIQRKFGAKVNFGD-------HNASD-------VKDGYMECTSYQDK-RFSIKINERDT 242

  Fly    66 ------YKSTGITHNEGGWPKD-INMHDPEQTVRYKRKI---EKD-ENYITQVMNLTKPMEHYIH 119
                  :.....|..:.|:|:: ...:.|.:....:||.   .|| ::::..|   :..:|..:.
 Frog   243 GIQVVPFTQENSTQTKWGYPRNACTQYTPREFTEEERKACLSSKDFKDFVNSV---SLRLELALQ 304

  Fly   120 QNNAVNIY----------ENYFENLDPAPLPEPCKSRTVNVYRDPNPIKVPVKHLSWSPDGGIKM 174
            ||..:|.:          ||.|.....:.|.| .:|.|.:::.:...|    ..::|.|.....:
 Frog   305 QNEIMNAFLDDWKALSEEENTFGGKSDSHLKE-SQSFTDHLFSNAKTI----SGINWHPKIHGLV 364

  Fly   175 AVSHCDMRFQGDKSNQKCNSYI-------WEVENPNEPFLTLEPKVPCVCLEYNQKDPTSLVSGM 232
            |||..:.....|:.|......:       |...:|..|.|.||......|.::...||..:..|.
 Frog   365 AVSMTERLSFEDRVNISSKILLKPSLILFWSFTDPLHPQLMLECPDDIYCFQFCPSDPNIIAGGC 429

  Fly   233 YNGQVAAWDTRHGKLPVM------------------------------ISEREVCHRDPVNSVLW 267
            :||||..||....:..:|                              :|..|..|::.:..:.|
 Frog   430 FNGQVVLWDISKYQESLMAKAGVSKNTAPKTGLEPSVPKGPQLVRYCAVSSIEHGHKNVITDIHW 494

  Fly   268 --NN-----------SKSG--TEFFSGGSDGQVLWWDTRKLTEPLDRLLMDPVKSDDQDLSRSYG 317
              ||           :|||  .:..:...|..:::||.|.     .:.|....|.:.:|....:|
 Frog   495 LPNNFELSNAGNPYENKSGYCLQLVTCSPDCSIMFWDIRP-----QKTLTAAEKKNVEDKQMPHG 554

  Fly   318 I----------------------------------------------------------SVLEYE 324
            :                                                          .|:||:
 Frog   555 VPDTFKYIDLTWRPFIRAILPKSDMSGEYSPMKISLSEEHHHCRTLDKLQIQAKEDKTEGVVEYK 619

  Fly   325 T-------------TIPTRFMAGTEMGMLFSCNRK-------GKTPTEKIQIRMMCHLGPVYAIT 369
            :             .|.|::..|||.|.|...:.|       ||..:.|.....:.|.|.|..:.
 Frog   620 SLRAASAKNPKLLDDINTKYFVGTEDGELVYTDWKMEKDSDTGKLISSKPLQANILHDGAVNTVQ 684

  Fly   370 RNPAFVKNF-LTVGDWCARIWSEDCRESSIIWTKSSSSMLTDGAWSYTKVSQFFITRMDGVLDTW 433
            |:| |:|:| ||||.|...||.|......|..:..|...||...||.::...|||.:.||.:|.|
 Frog   685 RSP-FLKDFILTVGGWNFAIWREGVTSGPIFHSCCSQKRLTAAHWSLSRTGVFFIGKEDGNVDVW 748

  Fly   434 DLLQQQNEPVLTVKVCDEPLYCVR---TNENGKFVSCGSQLGATFLVEVSDNMVMSAKNDKPLLT 495
            |||::.:||..|..:...|:..:|   .:....|::.|...|...::|:..|:...:.|:...:.
 Frog   749 DLLEKTHEPSQTQNIAAAPITYIRPWIASSKQHFLAVGDDQGTLHILEIPWNLRHPSANENASVQ 813

  Fly   496 AMFERE-------NRREKILEAKSRESKLKVKANHGQDQGDTMMVNGKINMAPFEAACEQAASEY 553
            ..||||       |:||.:.....::.:||             .::.|...:|.....||     
 Frog   814 HYFEREVKHVEYSNQREGLRATAKKQLELK-------------DLSAKTETSPPVKTKEQ----- 860

  Fly   554 FAAVEQERQRRL 565
             ..|||.::..|
 Frog   861 -TEVEQSKEYEL 871

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 96/456 (21%)
WD40 repeat 162..208 CDD:293791 11/53 (21%)
WD40 212..469 CDD:295369 81/384 (21%)
WD40 repeat 215..254 CDD:293791 12/69 (17%)
WD40 repeat 262..304 CDD:293791 11/57 (19%)
WD40 repeat 318..355 CDD:293791 14/115 (12%)
WD40 repeat 365..401 CDD:293791 15/37 (41%)
WD40 repeat 408..433 CDD:293791 10/25 (40%)
wdr63NP_001120428.1 WD40 <343..>548 CDD:225201 40/214 (19%)
WD40 repeat 723..763 CDD:293791 17/40 (43%)
WD40 repeat 769..814 CDD:293791 7/45 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.