DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and zgc:163143

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001077038.1 Gene:zgc:163143 / 795946 ZFINID:ZDB-GENE-070410-143 Length:413 Species:Danio rerio


Alignment Length:283 Identity:55/283 - (19%)
Similarity:94/283 - (33%) Gaps:89/283 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAVKNCGNNNRIANRTKWRYFH-FP-KEKPNLQRWIDFCQRDNINPT-TACICNEHF-------- 56
            |:..||.|    ..|.|...|| || |:...|::|:...:..:..|. .:.||:.||        
Zfish     5 CSAYNCKN----TLRNKSVSFHLFPLKDSSLLKKWLKNLRWKDWKPNPNSKICSAHFEEKCFILE 65

  Fly    57 ----------APNDFERNMQYELGFSRKNPTKLKPGS--------FPSVNGPQKLAKELRGSIKR 103
                      .|..|....:|    |.:| .|:.|.|        .||.:.......:...|:..
Zfish    66 GKKTRLHTWAVPTIFSFPNRY----SERN-VKINPRSRRARRIVGDPSSSIQAAETSDESNSVNP 125

  Fly   104 GSKSVPLAGSTKMSN------IGFDPHHAGTQS-SEGHETIEIQLCG------------------ 143
            ..:|...:..|..|.      .|..|:...||. :|..::::..:.|                  
Zfish   126 AQRSTDTSSHTNTSEANSSDLTGAKPNGDSTQQLTEPEKSLQWTILGDEVLDRSMTIPSFFHSGY 190

  Fly   144 -FNTDIEGFEEAEDDDC------------PSGPRLVEV---------EILDPLNPQSNAKDHVEI 186
             |..:|..   |.||:.            .:.|:::||         ::..|.:|..|...|:..
Zfish   191 CFPNNIRW---AGDDELNIVPHVVYGVLGQTKPQIIEVKARWEWLGLDVRGPFSPTVNKHTHIMT 252

  Fly   187 IDSEGDSYVKHLELEICSLKREV 209
            :......:|:...|.. ||.::|
Zfish   253 LTDYHSKWVEAFPLTE-SLSQDV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 28/113 (25%)
GrpE 198..>239 CDD:295646 4/12 (33%)
zgc:163143NP_001077038.1 THAP 5..82 CDD:283206 20/80 (25%)
Mucin-like <106..165 CDD:292676 11/58 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46600
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.