DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14135 and thap4

Sequence 1:NP_001261721.1 Gene:CG14135 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001072821.1 Gene:thap4 XenbaseID:XB-GENE-967122 Length:502 Species:Xenopus tropicalis

Alignment Length:319 Identity:66/320 (21%)
Similarity:109/320 (34%) Gaps:93/320 (29%)


  Fly     3 CAVKNCGNNNRIANRTKWRYFHFP-KEKPNLQRWIDFCQRDNINP-TTACICNEHFAPNDFERNM 65
            ||..:|.|......:....:..|| |:...|..|.|..||||..| ..:.:|::||:|..|.|.|
 Frog     5 CAAPSCTNRQGKGKKGDVSFHRFPLKDHVRLSLWTDALQRDNWTPGPYSFLCSDHFSPESFVRRM 69

  Fly    66 --QYELGFSRKNPT-------KLKPGSFPSVNG--PQKLAKELRGSIKRGSKSVPL------AGS 113
              |..|..|...|:       :.|.|:...|:|  .:|.|.::|..:.:|:.||.|      |.|
 Frog    70 PDQTPLLTSNAVPSLFKNSCGRRKRGTVLRVSGVRRKKKAPKIRPVLIQGNNSVELPSGNICAES 134

  Fly   114 TKMSNIGFDPHHAGTQSSEGHETIEIQLCGFNTDIEGFEEAEDDDCPSGPRLVEV--EILDPLNP 176
            .....|..|...||...:..........|.|.:.:..:..:...........|.:  :|:|.:.|
 Frog   135 QNSIIITDDFKDAGCFLTHDVSPNSSSACKFISCLHSYSSSAKPPLSQNGTKVNLFSQIMDVIKP 199

  Fly   177 Q-----------------SNAKD-------HVEIIDSEG----------------DSYVKHLE-- 199
            .                 |:.||       .||..:.:|                |::.::.|  
 Frog   200 SHTPTSEVLPYATSGVTPSDDKDSDNSHLCRVEFSNDKGSQIIHTVTAQHPVSMEDTHCENKESS 264

  Fly   200 ------------LEICSLKREVFF------------------LKDEYQKIKAEMRNLKD 228
                        ::||.::.|.:.                  |......:|.:.||:||
 Frog   265 TVETEDPSSQSDMQICPIQPENYSALYQDIHSLHSYCFQSKPLSGRRNHLKKKGRNMKD 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 29/96 (30%)
GrpE 198..>239 CDD:295646 10/64 (16%)
thap4NP_001072821.1 THAP 5..85 CDD:310232 26/80 (33%)
DUF1794 350..499 CDD:312339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002830
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.